KEGG   Photorhabdus luminescens: plu0074Help
Entry
plu0074           CDS       T00149                                 

Gene name
acs
Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
plu  Photorhabdus luminescens
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:plu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:plu00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:plu00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:plu00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:plu00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(71302..73257)
Genome map
AA seq 651 aa AA seqDB search
MTKIMKHPIPIAIAEHALMNEQQYQQDYQLSLQDPDRFWGEKGKIVDWIKPYTKVKNTSF
DPGHINIRWFEDGTLNLSANCLDRHLKERGEQTAIIWEGDDPTESKAITYRELHHDVCQF
ANVLKNMGIKKGDVVAIYMPMVPEAAVAMLACARIGAIHSVIFAGFSPDAVSGRIIDSNT
KLVITADEGLRAGRTIPLKKNVDDALNNAAVVNVSNVIVFKRTGNIGHWQSGRDLWWHEL
VADASADCPVEEINAEDPLFILYTSGSTGKPKGVLHTTGGYLVYASLTFKYVFDYQPGEV
YWCTADVGWVTGHSYLLYGPLSCGAITLMFEGVPNYPAVNRLSQIIDKHQVNILYTAPTA
IRALMAEGDKAIEGTKRTSLRIMGSVGEPINPEAWEWYYQKIGNSKCPIVDTWWQTETGG
FMITPLPGATELKAGSATLPFFGVQPALVDNLGEQLEGVCEGNLVITDSWPGQARSLFGD
HDRFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNISGHRLGTAEIESALVSHP
KIAEAAVVGTPHNIKGQAIYAYVTLNHGEEPSPELYTEVRNWVRKEIGPIATPDILHWTD
SLPKTRSGKIMRRILRKIASGDTNNLGDISTLADPGVVEKLLEEKQTMSIS
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaataatgaagcaccctattcctatcgccattgcagaacatgccctgatgaat
gagcaacaatatcagcaagactaccaattatcgttgcaagatcccgacaggttctggggt
gaaaaaggaaaaattgttgactggattaagccttacaccaaggtaaagaatacctctttt
gatcctggacatatcaatatccgctggtttgaagatggaacactaaacttaagcgcaaat
tgtctcgatcgtcatctaaaagaacgtggtgagcaaaccgctattatctgggaaggtgat
gatccaacagaatccaaagcaataacctatcgtgaactacaccatgatgtatgtcagttt
gccaatgtattgaaaaatatgggtattaaaaaaggcgatgttgttgctatttacatgccg
atggtgccagaagcagcggttgccatgttagcatgtgcccgcattggtgctattcactct
gttattttcgcaggtttttctcctgatgctgtatccgggcgtatcatcgattcaaacacc
aaattggtcattaccgccgatgaaggattaagagccggacgtacaatccccctgaaaaag
aatgttgatgacgcattaaataatgcagccgttgtcaatgtatccaatgtaatcgttttt
aaacgtactggaaatattggtcactggcaatctggccgtgacctttggtggcatgaattg
gtcgcagacgcgagtgctgactgtccagttgaagagataaatgcagaagacccgctgttt
attctctatacctcaggctctaccggtaaacccaaaggggtactgcacaccactggaggt
taccttgtatatgcatctctaacatttaaatacgtattcgattatcagccgggggaagtc
tattggtgcacagccgatgtgggatgggttaccggacatagctacctgctctacggcccc
ctttcctgtggtgctattaccctaatgtttgaaggcgtaccaaactatcctgcggttaac
cgcctaagtcagattattgataaacatcaggtaaatatcctatatacagcacccacagcg
attcgtgccctaatggcggaaggtgataaagctattgaaggaacaaaacgtacttccctg
cgtattatgggatcagttggcgaaccgattaatccggaagcttgggaatggtattaccag
aaaattggtaacagcaaatgcccgattgtcgatacctggtggcaaacagaaactggtggc
ttcatgatcacaccactaccaggcgcaaccgaactaaaagcaggttccgcaacgctacct
ttcttcggtgttcagcccgcattggttgataatcttggtgaacaactagaaggtgtttgt
gaaggaaacctagttattaccgattcctggccaggacaagcacgctcactatttggcgat
catgaccgtttcgaacaaacctatttctctacctttaagggaatgtattttagtggtgat
ggcgcacgccgtgatgaagatggctactattggataactggtcgtgttgatgatgtgctg
aatatttccggccaccgtctaggtactgctgaaattgaatcagctttggtctcccatcct
aaaattgcagaagctgctgtcgtaggtaccccacataatattaaagggcaggcaatttat
gcctatgtcaccttaaatcacggtgaagaaccctctccagaactctatacagaagtccgt
aattgggtacgtaaagaaatcggcccgattgctacaccagatatcctacactggacagac
tccttaccaaaaacccgttcaggaaaaattatgcgtcgtatcctgcgcaaaatagcctcc
ggcgataccaacaatctaggggacatttcaacactagcagatccaggagtagtagaaaaa
ttgttagaagaaaaacaaacaatgagtatttcgtga

DBGET integrated database retrieval system