KEGG   Photorhabdus luminescens: plu0565Help
Entry
plu0565           CDS       T00149                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
plu  Photorhabdus luminescens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    plu0565 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    plu0565 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    plu0565 (thrC)
Enzymes [BR:plu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     plu0565 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
639435..640733
Genome map
AA seq 432 aa AA seqDB search
MKLYNLKDNSEQVSFAQAVKQGLGKQQGLFFPQDLPEFSREEIDHLLKLDFVTRSGCILS
AFIGDEIPPEQLATRIKNAFTFPAPVTNVENDVATLELFHGPTLAFKDFGGRFMAQILAQ
VAGEQPVTILTATSGDTGAAVAHAFYGLNNVQVVILYPQGKISPLQEKLFCTLGGNIHTV
AIDGDFDDCQALVKQAFDDQELKQALYLNSANSINISRLLAQICYYFEAVAQLPEDQREQ
LVISVPSGNFGDLTAGLLAKSMGLPVKRFIAATNVNDTVPRYLEDGKWLPHQTVATLSNA
MDVSQPNNWPRIEELFHRKSWPLSELGYGVVNDDVTKETIKELAKHGYISEPHAAVAYRV
LRDQLQEGEYGLFLGTAHPAKFKESVEQILGEELPLPKALAERADLELLSHYLPADFAKL
RAFLMERAPKSL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataacttgaaagacaacagcgagcaggtgagttttgcacaagcagtcaaa
cagggattaggcaaacagcaagggcttttctttccgcaagatttacccgaattcagtcgt
gaagaaattgaccacctattgaaactggattttgtcacccgcagcggttgcattctctcc
gcgtttattggcgatgaaattccgccagaacaactggcaacacgaattaagaacgctttt
acttttccggcacctgttaccaacgtggaaaatgatgttgcaacattggaattattccac
ggcccgactctggcatttaaggattttggtggccgttttatggcgcaaatattggcacaa
gttgctggtgaacagccagtaactatcctgactgcgacttccggcgatacaggagcagca
gtagcgcacgccttttatgggctaaataatgtacaggtggtgatcctctatccacagggc
aaaatcagcccgttacaggagaaattgttctgtacattgggtggtaatattcacacggtg
gcgattgatggcgatttcgatgattgccaggcgttggttaaacaggcgtttgatgatcag
gagttgaaacaggctctgtatctcaattcagctaactcaattaacatcagccgcttgttg
gcacaaatttgctattactttgaagcggttgctcagctaccggaagatcagcgtgaacaa
ctggttatttctgtaccgagtgggaattttggtgatttaaccgcgggtttattggcaaaa
tcgatgggattgccggtaaaacgctttatcgctgccacgaatgttaacgatacagttcct
cgttatctagaggatggaaaatggttgcctcatcagaccgttgccacgctttccaacgca
atggatgtgagccagccaaacaactggccacgtattgaagaactgttccaccgtaaatcc
tggccattgagcgaattgggatatggtgtagtcaatgatgacgtgactaaagaaacgatt
aaggaactggctaaacacggttatatctctgaacctcatgccgcggtggcttatcgtgtc
ttgcgtgatcaattacaagaaggtgaatacggattatttcttggtacggcgcatccagcg
aaatttaaagagagtgtggagcagattctgggtgaggaattacccttgcccaaagctttg
gctgaacgggctgatctggagttgctatcccattacttaccggcagattttgctaagttg
cgagctttcttgatggaaagagcacccaagtcattatga

DBGET integrated database retrieval system