KEGG   Photorhabdus luminescens: plu0565Help
Entry
plu0565           CDS       T00149                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
plu  Photorhabdus luminescens
Pathway
plu00260  Glycine, serine and threonine metabolism
plu00750  Vitamin B6 metabolism
plu01100  Metabolic pathways
plu01110  Biosynthesis of secondary metabolites
plu01120  Microbial metabolism in diverse environments
plu01230  Biosynthesis of amino acids
Module
plu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    plu0565 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    plu0565 (thrC)
Enzymes [BR:plu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     plu0565 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: CAE12860
Pasteur: plu0565
UniProt: Q7N8Z4
Position
639435..640733
Genome map
AA seq 432 aa AA seqDB search
MKLYNLKDNSEQVSFAQAVKQGLGKQQGLFFPQDLPEFSREEIDHLLKLDFVTRSGCILS
AFIGDEIPPEQLATRIKNAFTFPAPVTNVENDVATLELFHGPTLAFKDFGGRFMAQILAQ
VAGEQPVTILTATSGDTGAAVAHAFYGLNNVQVVILYPQGKISPLQEKLFCTLGGNIHTV
AIDGDFDDCQALVKQAFDDQELKQALYLNSANSINISRLLAQICYYFEAVAQLPEDQREQ
LVISVPSGNFGDLTAGLLAKSMGLPVKRFIAATNVNDTVPRYLEDGKWLPHQTVATLSNA
MDVSQPNNWPRIEELFHRKSWPLSELGYGVVNDDVTKETIKELAKHGYISEPHAAVAYRV
LRDQLQEGEYGLFLGTAHPAKFKESVEQILGEELPLPKALAERADLELLSHYLPADFAKL
RAFLMERAPKSL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataacttgaaagacaacagcgagcaggtgagttttgcacaagcagtcaaa
cagggattaggcaaacagcaagggcttttctttccgcaagatttacccgaattcagtcgt
gaagaaattgaccacctattgaaactggattttgtcacccgcagcggttgcattctctcc
gcgtttattggcgatgaaattccgccagaacaactggcaacacgaattaagaacgctttt
acttttccggcacctgttaccaacgtggaaaatgatgttgcaacattggaattattccac
ggcccgactctggcatttaaggattttggtggccgttttatggcgcaaatattggcacaa
gttgctggtgaacagccagtaactatcctgactgcgacttccggcgatacaggagcagca
gtagcgcacgccttttatgggctaaataatgtacaggtggtgatcctctatccacagggc
aaaatcagcccgttacaggagaaattgttctgtacattgggtggtaatattcacacggtg
gcgattgatggcgatttcgatgattgccaggcgttggttaaacaggcgtttgatgatcag
gagttgaaacaggctctgtatctcaattcagctaactcaattaacatcagccgcttgttg
gcacaaatttgctattactttgaagcggttgctcagctaccggaagatcagcgtgaacaa
ctggttatttctgtaccgagtgggaattttggtgatttaaccgcgggtttattggcaaaa
tcgatgggattgccggtaaaacgctttatcgctgccacgaatgttaacgatacagttcct
cgttatctagaggatggaaaatggttgcctcatcagaccgttgccacgctttccaacgca
atggatgtgagccagccaaacaactggccacgtattgaagaactgttccaccgtaaatcc
tggccattgagcgaattgggatatggtgtagtcaatgatgacgtgactaaagaaacgatt
aaggaactggctaaacacggttatatctctgaacctcatgccgcggtggcttatcgtgtc
ttgcgtgatcaattacaagaaggtgaatacggattatttcttggtacggcgcatccagcg
aaatttaaagagagtgtggagcagattctgggtgaggaattacccttgcccaaagctttg
gctgaacgggctgatctggagttgctatcccattacttaccggcagattttgctaagttg
cgagctttcttgatggaaagagcacccaagtcattatga

DBGET integrated database retrieval system