KEGG   Photorhabdus luminescens: plu0577Help
Entry
plu0577           CDS       T00149                                 

Gene name
galM
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
plu  Photorhabdus luminescens
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:plu00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:plu00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
653781..654842
Genome map
AA seq 353 aa AA seqDB search
MNASMTQDIARDGKKANLVCLSNASGFSIVLMDIGASWLSCRVPLSGEKREVLLGIATLK
DFYKQTSYLGATVGRYANRIANGCFNLDGKTYQLQVNQAGNCLHGGIEGFDKRRWTITAR
DAYSVSFTLQSPDGDQGFPGNVVVTVRYVLTNDNHVIVDYLAHTDAATPINLTNHAYFNL
LGADAGKTCLSHHLEVKSDGYLPIDENGIPLGQLALVDNTGFDFRTPKAINSHFMLDKQQ
QIVNGYDHSFWLQATRLDTDYAISVTSPDEAITMKIFTTKPAVQFYSGNWLGGTPNRDGG
RYENYAGMAFEPQFLPDSPNHPEWEQESCILRPNQRYKHRTCYQFEIHNAYTH
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgcttcaatgacacaagatattgctagggatggaaaaaaagcaaatcttgtctgc
ctttccaatgcctcgggtttttctattgtgttgatggacattggtgcatcttggttaagt
tgccgtgtgcccttaagtggagagaaaagagaggttttactgggtattgccaccttaaaa
gatttttataaacagaccagttacttaggtgctaccgtaggacgatacgccaatcggatt
gcaaatggatgttttaatcttgatggtaaaacttatcaattacaggtaaatcaggcagga
aattgtttgcacggtgggattgagggttttgataagcggcgttggacaatcactgcaaga
gatgcttattcagtgagttttacattacagtcaccggatggtgatcaaggttttcctggt
aatgtcgttgtgaccgttcgttacgtattaaccaatgataatcacgtaatcgtggattat
ttagcccatacagatgctgcgacgcccattaatttgactaatcacgcttattttaattta
ttgggggcggatgctgggaaaacatgtttatcgcatcatctagaagtgaaaagtgacggc
tatttaccgattgatgaaaatggtattccattgggccaactggctttggttgataatacg
ggttttgattttcgaacacctaaagcaattaacagtcactttatgctggataaacagcag
caaattgtaaatggatatgatcattcattctggttgcaagcaacccgtttggacacggat
tatgcaatctcagtcacctcccctgatgaagcaatcacaatgaaaatattcaccacaaaa
ccggctgtgcagttttactcgggaaattggctaggtggaacgcctaaccgtgatggtggg
cgatatgagaactatgcgggaatggcatttgagccacaatttttgccggattctcccaac
catcctgaatgggagcaagagagctgtatacttcgtcctaaccaacgctataagcaccgt
acttgctatcaattcgaaatccataatgcttatacacattga

DBGET integrated database retrieval system