KEGG   Photorhabdus luminescens: plu1172Help
Entry
plu1172           CDS       T00149                                 

Definition
(GenBank) unnamed protein product; Highly similar to probable glutaminase YneH of Escherichia coli
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
plu  Photorhabdus luminescens
Pathway
plu00220  Arginine biosynthesis
plu00250  Alanine, aspartate and glutamate metabolism
plu00471  D-Glutamine and D-glutamate metabolism
plu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    plu1172
   00220 Arginine biosynthesis
    plu1172
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    plu1172
Enzymes [BR:plu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     plu1172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: CAE13466
Pasteur: plu1172
UniProt: Q7N7H7
Position
1356028..1356954
Genome map
AA seq 308 aa AA seqDB search
MSTTFSNTLLSDILRQVRPLIGQGKVANYIPALAEVPADNLAIAICTIDGQIFHAGDAEK
RFSIQSISKILSLTLAMTRYQEQEIWQRVGQEPSGQPFNSLVQLELEKGKPRNPFVNAGA
LIVCDMLQSRLSAPKQRMLEVVRKLAGCPDICYDSKVARSEMEHSHRNAAIAYLMKSFGN
FDNDVLAVLQTYFHYCALKMNCIELAKCFIYLANQGSTIGSEQQILSPRQARQINALMMT
CGMYDGSGEFAFRIGMPGKSGVGGGIVCVVPGEFTVTVWSPELDRSGNSLAGCAALELLA
DRVGRSVF
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgagtacaacgttctctaatacgttattgtcggatattttgcgacaagttcgtcccctg
attggccaagggaaagtggcaaattatattcctgcactggcggaggttcctgctgataac
ttggcaatagctatctgtactattgatgggcagatatttcatgcaggagatgctgagaag
cgtttttcgattcaatctatttctaaaatattaagtctgactttagccatgacacgttat
caggaacaagagatctggcagcgggtcgggcaggaaccttctggtcagccatttaactca
ttagttcagttggaactggaaaaaggcaaaccccgtaacccttttgttaacgcgggtgca
ttaattgtctgtgacatgttgcagtcgcgattgagtgcacctaaacagcgtatgctggaa
gtggtgcgcaaacttgctggttgtcctgatatttgttacgacagcaaagttgcccgttct
gaaatggaacattctcaccgcaatgcagcgattgcctatctgatgaaatccttcggtaat
ttcgataacgatgtgctcgcggtactgcaaacttattttcattattgcgctttgaaaatg
aactgtattgagcttgctaaatgtttcatttatttggcgaatcaagggagtacgataggt
tctgagcagcaaatccttagtcctcgtcaggcccggcagattaatgcactgatgatgacc
tgtggtatgtatgatggttccggtgaatttgcattcaggattggtatgccaggaaaatcg
ggcgttggtggtgggatcgtgtgtgtcgtgccgggagagtttactgttactgtttggtca
ccggaattggatcgatcggggaactctttggccggttgtgctgccctagaattgttagct
gatcgtgttgggcgatccgttttttaa

DBGET integrated database retrieval system