KEGG   Photorhabdus luminescens: plu1324Help
Entry
plu1324           CDS       T00149                                 

Gene name
chb
Definition
N-acetyl-beta-glucosaminidase)-beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
plu  Photorhabdus luminescens
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    plu1324 (chb)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    plu1324 (chb)
Enzymes [BR:plu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     plu1324 (chb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1540188..1542863
Genome map
AA seq 891 aa AA seqDB search
MKKFKLHTLAALTATVGLMGSAYASQTAQQVVDALSQLKVNYKVVDNQAGDHGVNCAVLG
ADWAKCNRVDITLTNGNQAIDSIDWAIYFHSIRQVLSVDNEQFKITRITGDLHRLEPTEK
FTGIKANEQVKLPFIGEYWQIYSTDFLPRWYATSGDAKPKVLVSTDTEDLSQFLSAFTDD
QWKRTQTDNNILMTPENRYMKNLQVKKVGSEKLRGQIIPTPKEVQIFPEDADLSGGVRLE
LGGLNDEAVILVRKRFTDQGIKLEDSGYSVATQIISSEFPGDWQVKGAYRLNVTQNGAQI
VAFDQSGVFYGLQSLLSLIPVDGDRKIATLTAKDAPRFEYRGALLDVGRNFHSKQAVLRL
LDQMASYKLNKLHIHLSDDEGWRLEIPGLPELTEVGSQRCHDLSETQCLLPQLGSGPDNN
NMGSGYFSRQDYIDILKYAKARYIDVIPEIDMPAHARAAVVSMEARYKKLIAQGNVKGAS
EYRLLDPTDTTRATSVQLYDRRSYLNPCMDSSKRFVEKVIGEIAAMHKVAGSPLETWHFG
GDEAKNIRLGDGFQDKNGPIVPGKGIIDKSAEDKPWAKSQICQKLIEQGVVKDIDHLASD
FAIEVSKIVNANGIERMQAWQDGLKHASSAKDFATKRVGVNFWDTLYDGGFDSVNDWANK
GYDVVISSPDYIYLDMPYEVHPQERGYYWAARFNDEAKIFSFAPNNIPQNAETSVDRDGN
AFSAKSDKPWPGAYGLSGQGWSETVRTDEQMEYMIYPRLLPLAERAWHRAGWELDYIPGQ
VYKRGETYKVDIDALNRDWTRFANLIGQRELSKLDKAGIAYRLPVPGAKVKRGILRANVA
LPGLVIQYSTDGGHNWEVYNNHKRPRVRGDVLIRSVSPDGKRYSRIDNVKA
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatttaaattgcatacattagcagcactgactgcaactgttggacttatgggt
tctgcatatgcttcccaaacagcgcagcaagtggttgatgcactgagtcaattaaaagtt
aattataaagttgttgataatcaggcaggagatcacggcgttaactgtgcggtactgggg
gcagattgggctaaatgtaatcgagtggatattactttaaccaatggtaatcaggcgatt
gactctattgactgggcgatttatttccacagtattcgtcaggtcctgagcgtggataat
gaacagtttaaaatcacgcgtattacgggcgatttacatagactggagccaaccgaaaaa
ttcaccggtattaaagctaatgagcaggtaaaactgccgtttattggagaatactggcag
atttacagcactgattttctacctcgctggtatgcaacgtcgggtgatgcgaagcctaaa
gtgcttgttagtacggatacagaagatctaagtcaattcttatctgctttcaccgatgat
cagtggaaacgcacacagacagataacaatattttgatgacgcctgaaaatcgttatatg
aagaatttgcaggtcaaaaaggttggatcagagaagttgcgtgggcaaattatcccgaca
ccaaaagaggttcagatttttcccgaggatgctgatttatctggcggggtgagactggaa
ttgggtggtttaaatgacgaggcagttattcttgtcagaaaacgttttactgatcaaggc
attaaattagaggatagtggttattcagttgcgacccagattatctcttcagagtttcct
ggcgattggcaggttaaaggggcttaccgtctgaatgtgacccagaatggggcacaaatt
gttgcttttgaccaatctggggtgttttacggtcttcaatctctgttgtcattaattcct
gttgatggcgataggaagattgctactttgacggcaaaagatgcgccccgctttgaatat
cgtggtgcactccttgatgtagggcgtaatttccacagtaaacaggctgttctgcgtttg
cttgaccaaatggcaagttacaaactgaataaactccatattcatctgtctgatgatgaa
ggttggcgtttggaaattcctggattacctgagttgacggaagttggcagccagcggtgt
catgatttaagtgaaactcaatgtttattaccacaattgggttcaggccccgataacaac
aacatggggagcggatatttcagccgtcaagattacattgatattctgaaatatgctaaa
gctcgttatatcgacgttattcctgaaattgatatgccagcccatgctcgtgccgcggtt
gtttctatggaagcccgctataaaaaattaattgctcaggggaatgtgaaaggggcgagt
gaatatcgtttgctcgatccaacggataccaccagagcaacatcggttcagctctatgat
cgccgcagttatttgaacccgtgtatggattcttcaaaacggtttgttgagaaagtcata
ggtgaaattgctgctatgcataaagtagcaggttcaccattggagacttggcattttggg
ggagatgaagcgaagaatatccgtttgggagacggattccaggataaaaatggtcctatc
gtaccgggtaagggcatcattgataaaagtgcggaagataaaccgtgggctaagtctcag
atttgtcagaagttgatagaacagggtgttgtgaaagacattgatcatcttgccagcgac
ttcgcaattgaagtgagcaaaattgtgaatgctaatggtatcgagaggatgcaggcatgg
caggatggtttaaaacatgctagcagtgctaaagattttgccaccaaacgcgttggggtg
aatttttgggacactctctacgatggcggctttgattcagtcaatgattgggcgaataag
ggctatgacgtggtgatatctagcccagattatatttatctggatatgccatatgaagtt
catccacaagaacgtggctattattgggcggctcgttttaacgatgaagctaagatcttt
agttttgcgcccaataacataccgcaaaatgctgaaacttccgttgaccgtgatggtaat
gcattcagtgcgaaaagtgataaaccgtggccgggtgcctatgggctttcaggtcaagga
tggagtgaaacggttcggactgatgagcagatggaatatatgatttatccgcgcttgttg
ccgctagcggaacgggcatggcaccgggccggttgggagttggattatattccgggccag
gtatataagcgtggagaaacgtataaagtcgatatagatgcgcttaatcgtgactggacc
cggttcgctaacctgatagggcaacgtgagcttagtaaactggataaagcgggcattgct
taccgtctaccggttccgggggctaaggtaaaacggggtattttgcgggctaatgttgct
ctgcctggattggtaatccagtattcgacggatggcggtcataactgggaagtttataac
aaccataaacgcccaagagtgagaggtgatgtgttgatccgttctgtcagcccggacggt
aaacgttacagtcgaattgataatgtaaaggcatga

DBGET integrated database retrieval system