KEGG   Photorhabdus luminescens: plu1324Help
Entry
plu1324           CDS       T00149                                 

Gene name
chb
Definition
N-acetyl-beta-glucosaminidase)-beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
plu  Photorhabdus luminescens
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:plu00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:plu00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1540188..1542863
Genome map
AA seq 891 aa AA seqDB search
MKKFKLHTLAALTATVGLMGSAYASQTAQQVVDALSQLKVNYKVVDNQAGDHGVNCAVLG
ADWAKCNRVDITLTNGNQAIDSIDWAIYFHSIRQVLSVDNEQFKITRITGDLHRLEPTEK
FTGIKANEQVKLPFIGEYWQIYSTDFLPRWYATSGDAKPKVLVSTDTEDLSQFLSAFTDD
QWKRTQTDNNILMTPENRYMKNLQVKKVGSEKLRGQIIPTPKEVQIFPEDADLSGGVRLE
LGGLNDEAVILVRKRFTDQGIKLEDSGYSVATQIISSEFPGDWQVKGAYRLNVTQNGAQI
VAFDQSGVFYGLQSLLSLIPVDGDRKIATLTAKDAPRFEYRGALLDVGRNFHSKQAVLRL
LDQMASYKLNKLHIHLSDDEGWRLEIPGLPELTEVGSQRCHDLSETQCLLPQLGSGPDNN
NMGSGYFSRQDYIDILKYAKARYIDVIPEIDMPAHARAAVVSMEARYKKLIAQGNVKGAS
EYRLLDPTDTTRATSVQLYDRRSYLNPCMDSSKRFVEKVIGEIAAMHKVAGSPLETWHFG
GDEAKNIRLGDGFQDKNGPIVPGKGIIDKSAEDKPWAKSQICQKLIEQGVVKDIDHLASD
FAIEVSKIVNANGIERMQAWQDGLKHASSAKDFATKRVGVNFWDTLYDGGFDSVNDWANK
GYDVVISSPDYIYLDMPYEVHPQERGYYWAARFNDEAKIFSFAPNNIPQNAETSVDRDGN
AFSAKSDKPWPGAYGLSGQGWSETVRTDEQMEYMIYPRLLPLAERAWHRAGWELDYIPGQ
VYKRGETYKVDIDALNRDWTRFANLIGQRELSKLDKAGIAYRLPVPGAKVKRGILRANVA
LPGLVIQYSTDGGHNWEVYNNHKRPRVRGDVLIRSVSPDGKRYSRIDNVKA
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatttaaattgcatacattagcagcactgactgcaactgttggacttatgggt
tctgcatatgcttcccaaacagcgcagcaagtggttgatgcactgagtcaattaaaagtt
aattataaagttgttgataatcaggcaggagatcacggcgttaactgtgcggtactgggg
gcagattgggctaaatgtaatcgagtggatattactttaaccaatggtaatcaggcgatt
gactctattgactgggcgatttatttccacagtattcgtcaggtcctgagcgtggataat
gaacagtttaaaatcacgcgtattacgggcgatttacatagactggagccaaccgaaaaa
ttcaccggtattaaagctaatgagcaggtaaaactgccgtttattggagaatactggcag
atttacagcactgattttctacctcgctggtatgcaacgtcgggtgatgcgaagcctaaa
gtgcttgttagtacggatacagaagatctaagtcaattcttatctgctttcaccgatgat
cagtggaaacgcacacagacagataacaatattttgatgacgcctgaaaatcgttatatg
aagaatttgcaggtcaaaaaggttggatcagagaagttgcgtgggcaaattatcccgaca
ccaaaagaggttcagatttttcccgaggatgctgatttatctggcggggtgagactggaa
ttgggtggtttaaatgacgaggcagttattcttgtcagaaaacgttttactgatcaaggc
attaaattagaggatagtggttattcagttgcgacccagattatctcttcagagtttcct
ggcgattggcaggttaaaggggcttaccgtctgaatgtgacccagaatggggcacaaatt
gttgcttttgaccaatctggggtgttttacggtcttcaatctctgttgtcattaattcct
gttgatggcgataggaagattgctactttgacggcaaaagatgcgccccgctttgaatat
cgtggtgcactccttgatgtagggcgtaatttccacagtaaacaggctgttctgcgtttg
cttgaccaaatggcaagttacaaactgaataaactccatattcatctgtctgatgatgaa
ggttggcgtttggaaattcctggattacctgagttgacggaagttggcagccagcggtgt
catgatttaagtgaaactcaatgtttattaccacaattgggttcaggccccgataacaac
aacatggggagcggatatttcagccgtcaagattacattgatattctgaaatatgctaaa
gctcgttatatcgacgttattcctgaaattgatatgccagcccatgctcgtgccgcggtt
gtttctatggaagcccgctataaaaaattaattgctcaggggaatgtgaaaggggcgagt
gaatatcgtttgctcgatccaacggataccaccagagcaacatcggttcagctctatgat
cgccgcagttatttgaacccgtgtatggattcttcaaaacggtttgttgagaaagtcata
ggtgaaattgctgctatgcataaagtagcaggttcaccattggagacttggcattttggg
ggagatgaagcgaagaatatccgtttgggagacggattccaggataaaaatggtcctatc
gtaccgggtaagggcatcattgataaaagtgcggaagataaaccgtgggctaagtctcag
atttgtcagaagttgatagaacagggtgttgtgaaagacattgatcatcttgccagcgac
ttcgcaattgaagtgagcaaaattgtgaatgctaatggtatcgagaggatgcaggcatgg
caggatggtttaaaacatgctagcagtgctaaagattttgccaccaaacgcgttggggtg
aatttttgggacactctctacgatggcggctttgattcagtcaatgattgggcgaataag
ggctatgacgtggtgatatctagcccagattatatttatctggatatgccatatgaagtt
catccacaagaacgtggctattattgggcggctcgttttaacgatgaagctaagatcttt
agttttgcgcccaataacataccgcaaaatgctgaaacttccgttgaccgtgatggtaat
gcattcagtgcgaaaagtgataaaccgtggccgggtgcctatgggctttcaggtcaagga
tggagtgaaacggttcggactgatgagcagatggaatatatgatttatccgcgcttgttg
ccgctagcggaacgggcatggcaccgggccggttgggagttggattatattccgggccag
gtatataagcgtggagaaacgtataaagtcgatatagatgcgcttaatcgtgactggacc
cggttcgctaacctgatagggcaacgtgagcttagtaaactggataaagcgggcattgct
taccgtctaccggttccgggggctaaggtaaaacggggtattttgcgggctaatgttgct
ctgcctggattggtaatccagtattcgacggatggcggtcataactgggaagtttataac
aaccataaacgcccaagagtgagaggtgatgtgttgatccgttctgtcagcccggacggt
aaacgttacagtcgaattgataatgtaaaggcatga

DBGET integrated database retrieval system