KEGG   Photorhabdus luminescens: plu1427Help
Entry
plu1427           CDS       T00149                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
plu  Photorhabdus luminescens
Pathway
plu00020  Citrate cycle (TCA cycle)
plu00190  Oxidative phosphorylation
plu00650  Butanoate metabolism
plu01100  Metabolic pathways
plu01110  Biosynthesis of secondary metabolites
plu01120  Microbial metabolism in diverse environments
plu01130  Biosynthesis of antibiotics
plu01200  Carbon metabolism
Module
plu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
plu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
plu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    plu1427 (sdhD)
   00650 Butanoate metabolism
    plu1427 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    plu1427 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CAE13720
Pasteur: plu1427
UniProt: Q7N6W0
Position
1714719..1715066
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRTGIHDWLLLRASAMIIVLYVLYMLGFIVTTPDITYEVWRGFFASSITKVF
TVLTLFSILAHAWIGMWQVLTDYVKPLALRLMLQLAIIVALMAYLIYGTIVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagtaacgcatctgcattgggtcgcacgggtatccatgattggctattattgcgc
gcgtccgcaatgattattgttttatatgttctttatatgctgggctttatcgttacaacg
ccggatatcacttatgaagtctggcggggtttcttcgcctcatccatcactaaagtcttc
actgtgctgacactgttttccattctggctcacgcctggattggtatgtggcaagtactc
actgactatgtaaagccgctggcactgcgtttaatgctgcaattagcgattatcgttgca
ctgatggcttacttgatttacggaacaattgtggtgtggggggtatag

DBGET integrated database retrieval system