KEGG   Photorhabdus luminescens: plu1471Help
Entry
plu1471           CDS       T00149                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase 1 (phosphoglyceromutase 1) (PGAM 1)
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
plu  Photorhabdus luminescens
Pathway
plu00010  Glycolysis / Gluconeogenesis
plu00260  Glycine, serine and threonine metabolism
plu00680  Methane metabolism
plu01100  Metabolic pathways
plu01110  Biosynthesis of secondary metabolites
plu01120  Microbial metabolism in diverse environments
plu01130  Biosynthesis of antibiotics
plu01200  Carbon metabolism
plu01230  Biosynthesis of amino acids
Module
plu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
plu_M00002  Glycolysis, core module involving three-carbon compounds
plu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    plu1471 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    plu1471 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    plu1471 (gpmA)
Enzymes [BR:plu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     plu1471 (gpmA)
Membrane trafficking [BR:plu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    plu1471 (gpmA)
Exosome [BR:plu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   plu1471 (gpmA)
  Exosomal proteins of melanoma cells
   plu1471 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAE13764
Pasteur: plu1471
UniProt: Q7N6S0
Position
complement(1764791..1765543)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESEWNRENRFTGWTDVALSEKGRAEAQQAGQLLKEEGFVFDFAYTSVL
KRAIHTLWNILDQVDQQWLPVEKSWKLNERHYGALQGLDKAETAAKYGDDQVKLWRRGFA
ITPPDLTKDDERFPGHDPRYANLKPEELPVTESLATTIERVIPYWEEVIKPRVAQGEKVI
IAAHGNSLRALVKYLDNMSEETILELNIPTAVPLVYEFDENMKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcactaaactggttctggtaagacatggcgaaagcgagtggaacagagagaac
cgtttcactggctggactgacgtcgcgttatctgaaaaaggtcgcgccgaagctcaacaa
gcagggcaactgttgaaagaagaaggttttgtttttgattttgcctacacctccgtgcta
aaacgcgctatccatacgctgtggaacattctggatcaggttgatcaacagtggttacct
gttgaaaaaagctggaaactaaatgaacgtcattatggcgctctgcaaggtttggacaaa
gcagaaaccgcagctaaatacggtgatgatcaggttaaactgtggcgtcgtggttttgct
atcaccccaccagatttaactaaagatgatgaacgtttcccaggccatgatccgcgttat
gcaaatttgaagccagaagagttacccgtgactgaaagcctggcaacaacgattgaacgc
gtgatcccttactgggaagaagtgatcaaaccgcgcgttgctcaaggtgagaaagtgatt
atcgcagcgcacggtaattctttgcgtgctttggttaaatatctggataatatgagcgaa
gaaaccattcttgagctgaatatcccaacagcagtacctttggtttatgaattcgacgaa
aacatgaaaccaatcaaacattactatctgggtaacgctgatgaaatcgcagcaaaagcc
gcggcggtagcaaaccaaggtaaggcaaaataa

DBGET integrated database retrieval system