KEGG   Photorhabdus luminescens: plu2111Help
Entry
plu2111           CDS       T00149                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
plu  Photorhabdus luminescens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:plu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    plu2111 (ruvA)
Enzymes [BR:plu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     plu2111 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
2494361..2494978
Genome map
AA seq 205 aa AA seqDB search
MIGRLRGIVLEKQPPLVLLETNGVGYEVHMPMTCFYELPDAGQEAVLFTHFVVREDAQLL
YGFNDKQERALFRELIKVNGVGPKLALAILSGMSAQQFVSAIEREAIVSLVKLPGVGKKT
AERLVVEMKDRFKGLNGDLFNQSSDINLPATAKQTTSDADSEAEAAAALVSLGYKPQEAS
RMVSKIAKPGADCETLIREALRAVL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgatagggcgtctcagaggaattgtgctggaaaaacaaccacctttggttttactggaa
acaaatggtgttggttatgaagtccatatgccaatgacctgtttttatgaattgcctgat
gccggacaggaagctgttctgtttactcactttgttgtgcgtgaagatgcgcaattactt
tatggttttaatgataagcaggagcgggcgctattccgtgaattaattaaagtgaatggt
gtagggcctaaattggcgttggctattctttcgggcatgtctgcgcagcaatttgtttct
gctattgaacgagaagcgatcgtttctctggttaaattgccgggtgtaggtaagaaaacc
gctgaacggttggtggttgaaatgaaagatcgctttaaagggctcaatggcgatctcttc
aatcagagcagtgatattaatttgccggcaacggccaaacagacaacttctgacgctgat
agcgaagcagaagctgctgcggcattagtctctctgggttacaagccacaagaggctagc
cgcatggtcagtaaaatcgctaaaccgggtgctgattgtgaaacacttatccgcgaagca
cttcgcgctgttctctaa

DBGET integrated database retrieval system