KEGG   Photorhabdus luminescens: plu2246Help
Entry
plu2246           CDS       T00149                                 

Definition
(GenBank) unnamed protein product; Highly similar to probable aldehyde dehydrogenase and similar to ketoglutarate semialdehyde dehydrogenase
  KO
K13877  
2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
plu  Photorhabdus luminescens
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    plu2246
   00053 Ascorbate and aldarate metabolism
    plu2246
Enzymes [BR:plu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     plu2246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
2640912..2642495
Genome map
AA seq 527 aa AA seqDB search
MLVTHSGRQFIGGRRQAEGERCLHSRRAVDNAPTGYAFYQATRHEVDLAAQAAADAFTRY
SQTSLEERAVFLDKIADEIDALGDDFIALVSEETALPPARIQGERSRTSGQMRLFATLLR
RGDMHAARIDTAQPARKPLPRVDIRQCHIPLGPIAVFGASNFPLAFSTAGGDTASALAAG
CSVVFKAHSGHMATAEIIAEAIGRAIIAAQMPAGVFNMIYGNSVGADLVKHPIIQAVGFT
GSLAGGRALFDMAMQRPQPIPVFAEMSSINPVIVLPNALAQRGKPIAQELANSFTLGSGQ
FCTKPGIILGIRSPEFDQFITQLTREITLRPAQSMLNQGTLLNYQKGIHQLDDEPLMTRL
AIGEHHENQASAMLYRADIALLLNKNALLQEEVFGPVAIVVEAESQYQLLRAIDCLQGQL
TATLIGEHDELANAHELSRRLQNIAGRVVVNGYPTGVEVCDAVVHGGPYPATSDVRGTSV
GTLAIWRFLRPVCFQNYPKSLLPLALQDHNPLNISRLINGVMSREVL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttggtaacacattcaggtaggcagtttattggtggtcgcaggcaagcagagggggaa
cgctgtttgcacagtcggcgggcggtggataacgcaccaacgggttatgcgttttatcaa
gctacacgacatgaggtcgatctcgccgcccaagccgccgccgatgcatttacccgttat
agccagacatcgttagaagaacgtgccgtttttttagataaaattgccgatgaaattgat
gctcttggtgatgacttcattgcccttgtatcagaagaaacggcgctaccaccagccaga
attcaaggtgaacggtcgagaaccagcgggcaaatgaggctgtttgccacgctgttacgc
cgtggtgatatgcatgctgcccgcattgatactgcgcaacctgcaagaaaacccctccct
agagttgatattcgccaatgccatattcctctaggccctattgcggttttcggtgccagt
aatttcccgttggctttttctactgctggtggtgacacggcgtcagcgttagcggcgggc
tgctctgttgttttcaaagcacatagtggccatatggctactgccgaaatcatcgcagaa
gccattggacgcgctattatcgccgcacaaatgcccgcgggtgtattcaatatgatttat
ggcaatagcgtgggggccgatctagtcaaacaccccattattcaggccgttggttttacc
ggttcacttgctggtggacgtgcactgttcgatatggcgatgcagcgaccacaacctatt
ccggtttttgctgaaatgtcgagtatcaacccggtcattgtgctgccaaacgccttagca
cagcgggggaaaccgatcgcccaagaactggcaaattcattcacattaggtagcggtcag
ttttgtaccaagccaggaataatcttgggtattcgttcaccagagtttgatcaatttatt
actcaattaacgcgggaaatcacgcttcgcccggcgcagtcaatgctgaaccaaggcaca
ttacttaactaccaaaaaggtattcatcaactggatgatgaacccttaatgacacggtta
gccattggcgaacatcatgaaaatcaggcaagtgcaatgttgtatcgtgcagatattgct
ttattgttgaataaaaatgctctgttacaagaggaggtttttggccctgttgctattgtg
gttgaagccgaaagccaatatcagcttttacgcgcaattgactgtttgcaggggcagctt
accgctaccttaattggtgagcacgatgaattagcgaatgcacatgagctcagtcgacga
ttacaaaacattgcgggcagggtggttgttaatggctacccgacaggcgttgaagtctgt
gatgccgtggttcatggcgggccttacccggcaacttccgatgtgagagggacttcagtt
ggtacactggccatctggcgttttctgcgcccagtctgcttccaaaactatcctaaatcc
ttacttccactcgcactgcaagaccataatccgttaaatatttctcgattaatcaatggg
gtgatgagccgggaagtgttgtaa

DBGET integrated database retrieval system