KEGG   Photorhabdus luminescens: plu2246Help
Entry
plu2246           CDS       T00149                                 

Definition
hypothetical protein
Orthology
K14519  
NADP-dependent aldehyde dehydrogenase [EC:1.2.1.4]
Organism
plu  Photorhabdus luminescens
Pathway
Caprolactam degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    plu2246
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    plu2246
Enzymes [BR:plu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.4  aldehyde dehydrogenase (NADP+)
     plu2246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
2640912..2642495
Genome map
AA seq 527 aa AA seqDB search
MLVTHSGRQFIGGRRQAEGERCLHSRRAVDNAPTGYAFYQATRHEVDLAAQAAADAFTRY
SQTSLEERAVFLDKIADEIDALGDDFIALVSEETALPPARIQGERSRTSGQMRLFATLLR
RGDMHAARIDTAQPARKPLPRVDIRQCHIPLGPIAVFGASNFPLAFSTAGGDTASALAAG
CSVVFKAHSGHMATAEIIAEAIGRAIIAAQMPAGVFNMIYGNSVGADLVKHPIIQAVGFT
GSLAGGRALFDMAMQRPQPIPVFAEMSSINPVIVLPNALAQRGKPIAQELANSFTLGSGQ
FCTKPGIILGIRSPEFDQFITQLTREITLRPAQSMLNQGTLLNYQKGIHQLDDEPLMTRL
AIGEHHENQASAMLYRADIALLLNKNALLQEEVFGPVAIVVEAESQYQLLRAIDCLQGQL
TATLIGEHDELANAHELSRRLQNIAGRVVVNGYPTGVEVCDAVVHGGPYPATSDVRGTSV
GTLAIWRFLRPVCFQNYPKSLLPLALQDHNPLNISRLINGVMSREVL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttggtaacacattcaggtaggcagtttattggtggtcgcaggcaagcagagggggaa
cgctgtttgcacagtcggcgggcggtggataacgcaccaacgggttatgcgttttatcaa
gctacacgacatgaggtcgatctcgccgcccaagccgccgccgatgcatttacccgttat
agccagacatcgttagaagaacgtgccgtttttttagataaaattgccgatgaaattgat
gctcttggtgatgacttcattgcccttgtatcagaagaaacggcgctaccaccagccaga
attcaaggtgaacggtcgagaaccagcgggcaaatgaggctgtttgccacgctgttacgc
cgtggtgatatgcatgctgcccgcattgatactgcgcaacctgcaagaaaacccctccct
agagttgatattcgccaatgccatattcctctaggccctattgcggttttcggtgccagt
aatttcccgttggctttttctactgctggtggtgacacggcgtcagcgttagcggcgggc
tgctctgttgttttcaaagcacatagtggccatatggctactgccgaaatcatcgcagaa
gccattggacgcgctattatcgccgcacaaatgcccgcgggtgtattcaatatgatttat
ggcaatagcgtgggggccgatctagtcaaacaccccattattcaggccgttggttttacc
ggttcacttgctggtggacgtgcactgttcgatatggcgatgcagcgaccacaacctatt
ccggtttttgctgaaatgtcgagtatcaacccggtcattgtgctgccaaacgccttagca
cagcgggggaaaccgatcgcccaagaactggcaaattcattcacattaggtagcggtcag
ttttgtaccaagccaggaataatcttgggtattcgttcaccagagtttgatcaatttatt
actcaattaacgcgggaaatcacgcttcgcccggcgcagtcaatgctgaaccaaggcaca
ttacttaactaccaaaaaggtattcatcaactggatgatgaacccttaatgacacggtta
gccattggcgaacatcatgaaaatcaggcaagtgcaatgttgtatcgtgcagatattgct
ttattgttgaataaaaatgctctgttacaagaggaggtttttggccctgttgctattgtg
gttgaagccgaaagccaatatcagcttttacgcgcaattgactgtttgcaggggcagctt
accgctaccttaattggtgagcacgatgaattagcgaatgcacatgagctcagtcgacga
ttacaaaacattgcgggcagggtggttgttaatggctacccgacaggcgttgaagtctgt
gatgccgtggttcatggcgggccttacccggcaacttccgatgtgagagggacttcagtt
ggtacactggccatctggcgttttctgcgcccagtctgcttccaaaactatcctaaatcc
ttacttccactcgcactgcaagaccataatccgttaaatatttctcgattaatcaatggg
gtgatgagccgggaagtgttgtaa

DBGET integrated database retrieval system