KEGG   Photorhabdus luminescens: plu2246Help
Entry
plu2246           CDS       T00149                                 

Definition
hypothetical protein
Orthology
K14519  
NADP-dependent aldehyde dehydrogenase [EC:1.2.1.4]
Organism
plu  Photorhabdus luminescens
Pathway
Caprolactam degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:plu01220]
Metabolism; Xenobiotics biodegradation and metabolism; Caprolactam degradation [PATH:plu00930]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
2640912..2642495
Genome map
AA seq 527 aa AA seqDB search
MLVTHSGRQFIGGRRQAEGERCLHSRRAVDNAPTGYAFYQATRHEVDLAAQAAADAFTRY
SQTSLEERAVFLDKIADEIDALGDDFIALVSEETALPPARIQGERSRTSGQMRLFATLLR
RGDMHAARIDTAQPARKPLPRVDIRQCHIPLGPIAVFGASNFPLAFSTAGGDTASALAAG
CSVVFKAHSGHMATAEIIAEAIGRAIIAAQMPAGVFNMIYGNSVGADLVKHPIIQAVGFT
GSLAGGRALFDMAMQRPQPIPVFAEMSSINPVIVLPNALAQRGKPIAQELANSFTLGSGQ
FCTKPGIILGIRSPEFDQFITQLTREITLRPAQSMLNQGTLLNYQKGIHQLDDEPLMTRL
AIGEHHENQASAMLYRADIALLLNKNALLQEEVFGPVAIVVEAESQYQLLRAIDCLQGQL
TATLIGEHDELANAHELSRRLQNIAGRVVVNGYPTGVEVCDAVVHGGPYPATSDVRGTSV
GTLAIWRFLRPVCFQNYPKSLLPLALQDHNPLNISRLINGVMSREVL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttggtaacacattcaggtaggcagtttattggtggtcgcaggcaagcagagggggaa
cgctgtttgcacagtcggcgggcggtggataacgcaccaacgggttatgcgttttatcaa
gctacacgacatgaggtcgatctcgccgcccaagccgccgccgatgcatttacccgttat
agccagacatcgttagaagaacgtgccgtttttttagataaaattgccgatgaaattgat
gctcttggtgatgacttcattgcccttgtatcagaagaaacggcgctaccaccagccaga
attcaaggtgaacggtcgagaaccagcgggcaaatgaggctgtttgccacgctgttacgc
cgtggtgatatgcatgctgcccgcattgatactgcgcaacctgcaagaaaacccctccct
agagttgatattcgccaatgccatattcctctaggccctattgcggttttcggtgccagt
aatttcccgttggctttttctactgctggtggtgacacggcgtcagcgttagcggcgggc
tgctctgttgttttcaaagcacatagtggccatatggctactgccgaaatcatcgcagaa
gccattggacgcgctattatcgccgcacaaatgcccgcgggtgtattcaatatgatttat
ggcaatagcgtgggggccgatctagtcaaacaccccattattcaggccgttggttttacc
ggttcacttgctggtggacgtgcactgttcgatatggcgatgcagcgaccacaacctatt
ccggtttttgctgaaatgtcgagtatcaacccggtcattgtgctgccaaacgccttagca
cagcgggggaaaccgatcgcccaagaactggcaaattcattcacattaggtagcggtcag
ttttgtaccaagccaggaataatcttgggtattcgttcaccagagtttgatcaatttatt
actcaattaacgcgggaaatcacgcttcgcccggcgcagtcaatgctgaaccaaggcaca
ttacttaactaccaaaaaggtattcatcaactggatgatgaacccttaatgacacggtta
gccattggcgaacatcatgaaaatcaggcaagtgcaatgttgtatcgtgcagatattgct
ttattgttgaataaaaatgctctgttacaagaggaggtttttggccctgttgctattgtg
gttgaagccgaaagccaatatcagcttttacgcgcaattgactgtttgcaggggcagctt
accgctaccttaattggtgagcacgatgaattagcgaatgcacatgagctcagtcgacga
ttacaaaacattgcgggcagggtggttgttaatggctacccgacaggcgttgaagtctgt
gatgccgtggttcatggcgggccttacccggcaacttccgatgtgagagggacttcagtt
ggtacactggccatctggcgttttctgcgcccagtctgcttccaaaactatcctaaatcc
ttacttccactcgcactgcaagaccataatccgttaaatatttctcgattaatcaatggg
gtgatgagccgggaagtgttgtaa

DBGET integrated database retrieval system