KEGG   Photorhabdus luminescens: plu2272Help
Entry
plu2272           CDS       T00149                                 

Definition
hypothetical protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
plu  Photorhabdus luminescens
Pathway
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    plu2272
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    plu2272
Enzymes [BR:plu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     plu2272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
2668735..2670048
Genome map
AA seq 437 aa AA seqDB search
MIKVIYTNNKEQWKEGLSIIKTDEKANLIVTNNRGRKLDGFGGCFNELGMKALLDLDKEN
KKTVLDKLFSPDGECKLTLARIPIGASDYAISWYSLNDIEDDYNMAHFSIQRDRNLLIPY
IKEALKRQPNLKISASPWSPPVWLKTHQVYNFGRLKSDVQSQNAYALYFAKFIEEYQKEG
ISIDQIHIQNEVAADQKFPSCVWSGEQLREFIKKYLGPKFEQNNVKTEIWLGTINAPEFS
KEIGQDYDDYANCVLRDIDAYKYIKGVGYQWQGKNAIQRTVQSYPELRYYQTENECGDGH
NSWEYAHYVFTLFRHYLTNGANGYLYWNMVLHSGGESSWGWKQNSMISIPKGINEVIYNP
EYYVMRHFSGLILPDAQHIELEGSMSGNAVAFENKTGSLVVNINNSYKEKQKINISYNND
IWSIYLEPNSINSIIFN
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagttatctatacaaataataaagaacaatggaaagaaggattgtcgatcata
aaaacagatgagaaagccaatttaattgtcactaataatcgaggtcgaaaattagatggc
tttggcggttgttttaatgaacttgggatgaaagctttattagatctggataaagaaaat
aaaaaaactgtgttagataagttattttcgccagatggtgaatgcaaattaacattagcc
agaatacctattggtgccagcgattatgccatttcttggtatagtttaaatgatattgaa
gatgattataatatggcacacttttcgattcaaagagatagaaatttactgattccctat
ataaaggaagcgttaaaaagacaaccaaatttaaaaatatctgcttcaccgtggagtccg
ccggtatggcttaagactcaccaagtctataattttggcagattaaaaagcgatgttcaa
agccagaatgcatatgctttatattttgcaaaatttatcgaagagtatcagaaagaaggt
atttcaattgatcaaattcatatccagaatgaagttgctgcggatcaaaaatttccttct
tgtgtgtggagcggtgaacagttaagagagtttataaaaaaatatctcggtccgaaattt
gaacaaaataatgtaaaaactgagatttggctaggtactattaatgcccctgagttctct
aaagaaattggacaggattatgatgattatgcaaattgtgtattgcgtgacatagacgcc
tataaatatataaaaggcgttggttatcaatggcaaggaaaaaatgctattcaaagaacg
gtacaaagctatccagaattaagatattatcaaactgaaaatgagtgtggtgatggtcat
aatagttgggaatatgctcattatgtctttacccttttcaggcattatttaaccaatggt
gctaatggttatttgtactggaatatggtgctgcattcaggtggagaaagtagttggggc
tggaaacagaatagcatgataagtattccaaaaggaataaatgaagtgatatataatcca
gagtattatgtcatgcgtcatttttctggtttaattttgcctgatgcacaacatattgaa
ttagaaggtagtatgtcaggaaatgccgttgctttcgagaataaaacaggttcccttgtg
gtgaatataaataactcttataaagaaaagcaaaaaataaatattagttataataatgat
atttggtctatttatttggaacctaactcgattaattctattatctttaactaa

DBGET integrated database retrieval system