KEGG   Photorhabdus luminescens: plu2275Help
Entry
plu2275           CDS       T00149                                 

Gene name
xylA
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
plu  Photorhabdus luminescens
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    plu2275 (xylA)
   00051 Fructose and mannose metabolism
    plu2275 (xylA)
Enzymes [BR:plu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     plu2275 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
2673062..2674381
Genome map
AA seq 439 aa AA seqDB search
MHRYFERVNRISYEGRQSNNPLAFRHYNPEEIILGKKMKDHLRFAVCYWHNFCWDGTDMF
GSGAFERFWQKGGDALELAKLKADVAFEFFYKLNIPFYCFHDIDVAPEGCSLKEYIYNLG
VMSDILADKQAETGVKLLWGTANCFTHPRYAAGASTNPDLNIFAYASAQVCQVMQMTKKL
GGENYVLWGGREGYESLLNTDLRQEREQIGRFMQMVVDYKYKIGFQGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLENEIKVNIEANHATLAGHSFQHEVATAIALGILGSIDANRG
DAQLGWDTDQFPNSVEENSLVMYEILKAGGFTTGGLNFDAKVRRQSIDIDDLFYGHIGAI
DTMALSLKSAVKILVDGKLDEYVAQRYSGWNSELGRDILEGKMTLDEVAHYAETLVQEPK
HRSGQQELLENLINRYIYD
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcaccggtattttgagagagtaaatagaattagttacgaaggtaggcaaagtaataat
ccattagctttccgtcactacaaccccgaagagattattctaggcaaaaagatgaaagat
catctgcgttttgccgtctgctattggcacaatttttgttgggatggtactgatatgttt
ggttctggggcatttgagcgtttttggcaaaaagggggtgatgctttagaactggcgaag
cttaaagctgatgttgcttttgaatttttctacaaactcaatattcctttttattgtttc
cacgatattgatgttgcccccgaaggttgttccttaaaagaatatatttataatttgggt
gtcatgtccgatattcttgcagataaacaagcagaaactggcgttaaattattatgggga
acggcaaactgttttacacatcctcgttatgctgccggtgcgtcaacgaatccagatctc
aatattttcgcttatgcatcagcacaagtatgtcaagttatgcaaatgactaaaaagcta
ggtggtgaaaattatgtactgtggggcggacgtgaaggctatgaaagtttgctcaataca
gatttacgtcaagaaagagaacaaatcggccgttttatgcaaatggttgtggattataaa
tacaaaattggttttcagggaacattgctaattgaacctaaacctcaggaaccgactaaa
caccaatatgattatgatgtagcgactgtttatggtttcctaaagcagtttggtttagaa
aatgaaattaaggtgaatattgaagctaaccatgccacattagctggacactcatttcaa
catgaagttgccaccgcgattgcattgggaatattgggctctattgatgcgaatcgcggg
gatgctcaattgggttgggataccgatcaatttccaaatagtgtcgaagagaattctctt
gtaatgtatgaaatcttaaaagctggtggctttaccacgggtggtttaaatttcgatgca
aaagttcgccgtcaaagtattgatattgatgatctgttttatgggcatatcggtgccatc
gatactatggctttatcattaaagagcgcggtgaaaatattagtagacggtaaattagat
gaatatgtcgctcagcgttattctggttggaatagtgaattaggtagagatattcttgaa
ggaaaaatgacacttgatgaagtggctcactatgcagaaacattagttcaggaacctaaa
catcgaagtgggcaacaggaattactcgaaaatcttattaatcgctatatttatgattaa

DBGET integrated database retrieval system