KEGG   Photorhabdus luminescens: plu2465Help
Entry
plu2465           CDS       T00149                                 

Gene name
trpC
Definition
(GenBank) tryptophan biosynthesis protein TrpCF [includes: indole-3-glycerol phosphate synthase (IGPS); N-(5'-phospho-ribosyl)anthrnilate isomerase (PRAI)]
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
plu  Photorhabdus luminescens
Pathway
plu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
plu01100  Metabolic pathways
plu01110  Biosynthesis of secondary metabolites
plu01130  Biosynthesis of antibiotics
plu01230  Biosynthesis of amino acids
Module
plu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    plu2465 (trpC)
Enzymes [BR:plu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     plu2465 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     plu2465 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CAE14839
Pasteur: plu2465
UniProt: Q7N487
Position
2904817..2906181
Genome map
AA seq 454 aa AA seqDB search
MQATILQKIVNDKAEYLIHRKQQQPLESFINAVVASNRHFYQALNSEQTVFILECKKASP
SKGVIRQDFDPIQIAKIYQPYATAISVLTDEKYFQGNYEFLRLVSDAVHQPVLCKDFIID
PYQVYLARYYQADAILLMLSVLDDQQYITLSELAHSLNMGVLTEISSEEERARAVALKAK
VIGINNRDLRDLSIDLNRTKQLAPQLPEETIVISESGIHQHQQIRELSHYANGFLIGSAL
MAQPNLDLALRQLILGENKVCGLTRPQDAKVALQAGAVYGGLIFAEHSPRKINIQQAQQI
INAANLKYVGVFQNQSSAFISHTARILSLAAVQLHGAEGEVYIEELRKILPENCQIWKAI
DMSKDEFHTKAGNVDRYLLDNGKGGTGQSFDWQLLEKQSLANIMLAGGLNEENCQQAAKY
GCCGLDFNSGVENAPGIKSSHKLNKVFQLLRCYQ
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctaccattttacagaaaattgttaatgataaagccgaatatcttattcatcgt
aaacagcaacaaccattggaaagttttattaatgctgttgttgccagcaaccgtcatttt
tatcaggcactaaacagtgaacagaccgtttttattctggaatgtaaaaaggcatctcct
tctaaaggcgttattcgccaagattttgatccaattcaaatagcgaaaatttatcagccc
tatgcaaccgccatctctgtattaaccgatgaaaaatattttcaaggcaactatgaattt
cttcgtttagtcagtgatgccgttcaccagccggtattgtgcaaagattttattatcgat
ccttatcaggtttatcttgcccgctattatcaagccgatgcgattttgctgatgctttct
gttcttgatgatcagcaatatattacgctgtctgaacttgcgcatagcctgaatatgggc
gtcctgactgaaatcagctcagaagaagagcgagccagagcggttgcactaaaagctaaa
gtaataggtatcaataaccgtgatctgagagatctttctatcgatttaaaccgtaccaaa
caacttgcgccacagttaccggaagaaactattgttattagcgaatcgggtatccaccag
catcaacaaattcgtgagcttagccattatgctaatggctttctcattggcagtgctttg
atggctcaacccaatctggatttagcattacgtcaactgattctgggtgaaaataaagtc
tgtggattaactcggccacaagatgcgaaagtggcattacaggcaggtgctgtttatggt
ggtttgatatttgctgaacattcaccgcgtaaaattaatatccaacaggcccaacaaatt
atcaatgcagcaaatctcaaatatgtcggggtatttcaaaatcaatcatctgcattcatc
agtcataccgcccgtatcctttctctggctgcggtgcaattacatggtgccgaaggcgaa
gtttatattgaggaattgcgaaaaatattgcctgaaaattgtcaaatctggaaagcaatt
gatatgtcgaaagatgaatttcacaccaaagccggaaatgttgaccgttatttacttgat
aacggcaaaggtggaaccggccaaagtttcgattggcaattacttgaaaaacaatcactc
gccaacatcatgctcgccggtggattaaatgaagaaaattgccaacaagccgcaaaatat
ggctgttgcggacttgattttaactctggcgtcgaaaacgcacctggcattaaaagcagt
cataaactaaataaggtgtttcaactgttacgctgttaccaataa

DBGET integrated database retrieval system