KEGG   Photorhabdus luminescens: plu2465Help
Entry
plu2465           CDS       T00149                                 

Gene name
trpC
Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase (EC:4.1.1.48 5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
plu  Photorhabdus luminescens
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    plu2465 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    plu2465 (trpC)
Enzymes [BR:plu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     plu2465 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     plu2465 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
2904817..2906181
Genome map
AA seq 454 aa AA seqDB search
MQATILQKIVNDKAEYLIHRKQQQPLESFINAVVASNRHFYQALNSEQTVFILECKKASP
SKGVIRQDFDPIQIAKIYQPYATAISVLTDEKYFQGNYEFLRLVSDAVHQPVLCKDFIID
PYQVYLARYYQADAILLMLSVLDDQQYITLSELAHSLNMGVLTEISSEEERARAVALKAK
VIGINNRDLRDLSIDLNRTKQLAPQLPEETIVISESGIHQHQQIRELSHYANGFLIGSAL
MAQPNLDLALRQLILGENKVCGLTRPQDAKVALQAGAVYGGLIFAEHSPRKINIQQAQQI
INAANLKYVGVFQNQSSAFISHTARILSLAAVQLHGAEGEVYIEELRKILPENCQIWKAI
DMSKDEFHTKAGNVDRYLLDNGKGGTGQSFDWQLLEKQSLANIMLAGGLNEENCQQAAKY
GCCGLDFNSGVENAPGIKSSHKLNKVFQLLRCYQ
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctaccattttacagaaaattgttaatgataaagccgaatatcttattcatcgt
aaacagcaacaaccattggaaagttttattaatgctgttgttgccagcaaccgtcatttt
tatcaggcactaaacagtgaacagaccgtttttattctggaatgtaaaaaggcatctcct
tctaaaggcgttattcgccaagattttgatccaattcaaatagcgaaaatttatcagccc
tatgcaaccgccatctctgtattaaccgatgaaaaatattttcaaggcaactatgaattt
cttcgtttagtcagtgatgccgttcaccagccggtattgtgcaaagattttattatcgat
ccttatcaggtttatcttgcccgctattatcaagccgatgcgattttgctgatgctttct
gttcttgatgatcagcaatatattacgctgtctgaacttgcgcatagcctgaatatgggc
gtcctgactgaaatcagctcagaagaagagcgagccagagcggttgcactaaaagctaaa
gtaataggtatcaataaccgtgatctgagagatctttctatcgatttaaaccgtaccaaa
caacttgcgccacagttaccggaagaaactattgttattagcgaatcgggtatccaccag
catcaacaaattcgtgagcttagccattatgctaatggctttctcattggcagtgctttg
atggctcaacccaatctggatttagcattacgtcaactgattctgggtgaaaataaagtc
tgtggattaactcggccacaagatgcgaaagtggcattacaggcaggtgctgtttatggt
ggtttgatatttgctgaacattcaccgcgtaaaattaatatccaacaggcccaacaaatt
atcaatgcagcaaatctcaaatatgtcggggtatttcaaaatcaatcatctgcattcatc
agtcataccgcccgtatcctttctctggctgcggtgcaattacatggtgccgaaggcgaa
gtttatattgaggaattgcgaaaaatattgcctgaaaattgtcaaatctggaaagcaatt
gatatgtcgaaagatgaatttcacaccaaagccggaaatgttgaccgttatttacttgat
aacggcaaaggtggaaccggccaaagtttcgattggcaattacttgaaaaacaatcactc
gccaacatcatgctcgccggtggattaaatgaagaaaattgccaacaagccgcaaaatat
ggctgttgcggacttgattttaactctggcgtcgaaaacgcacctggcattaaaagcagt
cataaactaaataaggtgtttcaactgttacgctgttaccaataa

DBGET integrated database retrieval system