KEGG   Photorhabdus luminescens: plu2467Help
Entry
plu2467           CDS       T00149                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
plu  Photorhabdus luminescens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    plu2467 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    plu2467 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    plu2467 (trpA)
Enzymes [BR:plu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     plu2467 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
2907448..2908254
Genome map
AA seq 268 aa AA seqDB search
MERYEQLFKQLESRKQGAFVPFVTLGDPTPELSLKIIDALITGGADALELSIPFSDPLAD
GPTIQNANLRAFSSNVTPTLCFELLTKIRAKYPDIPIGLLMYANLVFHHGIDEFYRRCKD
TDIDSVLVADVPMSESRPFRTAAMKHGIAPIFICPPDAEDELLREIASYGRGYTYLLSRA
GVTGIERRGEKPLNHLVNKLREYHAAPPLQGFGISEPKQVKETLASGAAGAISGSAIVKI
IEENLSQPEIMLKELTEFVSKMKSATQL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttacgagcagctatttaagcaactggaaagtcgtaaacaaggtgcttttgtc
ccctttgtcacactcggtgatccaaccccagaattatcattgaaaattattgatgcactg
attaccggtggtgctgatgctcttgagttaagtattcctttttccgatccgctggctgac
ggcccgacaattcagaatgctaatctacgcgctttctcctcaaatgtaactcccacgctc
tgttttgaactattaacaaaaattcgggcaaaatatcctgatattcctattggtttatta
atgtatgccaacctggtttttcatcatggaatagatgagttctaccgccgttgcaaagat
acagatatcgattcggtattagttgcagatgttcctatgtcagaatcacggccattccgt
accgcagccatgaaacatgggattgcccccatttttatttgtccccccgacgcggaagat
gaactattacgtgaaattgcttcttatggccgcggatatacctacttattatcaagagca
ggagtaaccggtatagaaagacgaggtgaaaaaccattaaatcatctagtcaataaacta
cgagaatatcatgctgcaccaccgttacagggatttggtatttcagaacctaagcaggta
aaagaaacattagcgagtggcgcagcaggagccatttcaggttctgccatcgttaaaatt
atcgaagaaaatctttctcagccagaaataatgctgaaagaactgactgaatttgtatca
aaaatgaagtctgccacgcaactgtag

DBGET integrated database retrieval system