KEGG   Photorhabdus luminescens: plu2467Help
Entry
plu2467           CDS       T00149                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
plu  Photorhabdus luminescens
Pathway
plu00260  Glycine, serine and threonine metabolism
plu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
plu01100  Metabolic pathways
plu01110  Biosynthesis of secondary metabolites
plu01130  Biosynthesis of antibiotics
plu01230  Biosynthesis of amino acids
Module
plu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    plu2467 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    plu2467 (trpA)
Enzymes [BR:plu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     plu2467 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth NMO
Motif
Other DBs
NCBI-ProteinID: CAE14841
Pasteur: plu2467
UniProt: Q7N485
Position
2907448..2908254
Genome map
AA seq 268 aa AA seqDB search
MERYEQLFKQLESRKQGAFVPFVTLGDPTPELSLKIIDALITGGADALELSIPFSDPLAD
GPTIQNANLRAFSSNVTPTLCFELLTKIRAKYPDIPIGLLMYANLVFHHGIDEFYRRCKD
TDIDSVLVADVPMSESRPFRTAAMKHGIAPIFICPPDAEDELLREIASYGRGYTYLLSRA
GVTGIERRGEKPLNHLVNKLREYHAAPPLQGFGISEPKQVKETLASGAAGAISGSAIVKI
IEENLSQPEIMLKELTEFVSKMKSATQL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttacgagcagctatttaagcaactggaaagtcgtaaacaaggtgcttttgtc
ccctttgtcacactcggtgatccaaccccagaattatcattgaaaattattgatgcactg
attaccggtggtgctgatgctcttgagttaagtattcctttttccgatccgctggctgac
ggcccgacaattcagaatgctaatctacgcgctttctcctcaaatgtaactcccacgctc
tgttttgaactattaacaaaaattcgggcaaaatatcctgatattcctattggtttatta
atgtatgccaacctggtttttcatcatggaatagatgagttctaccgccgttgcaaagat
acagatatcgattcggtattagttgcagatgttcctatgtcagaatcacggccattccgt
accgcagccatgaaacatgggattgcccccatttttatttgtccccccgacgcggaagat
gaactattacgtgaaattgcttcttatggccgcggatatacctacttattatcaagagca
ggagtaaccggtatagaaagacgaggtgaaaaaccattaaatcatctagtcaataaacta
cgagaatatcatgctgcaccaccgttacagggatttggtatttcagaacctaagcaggta
aaagaaacattagcgagtggcgcagcaggagccatttcaggttctgccatcgttaaaatt
atcgaagaaaatctttctcagccagaaataatgctgaaagaactgactgaatttgtatca
aaaatgaagtctgccacgcaactgtag

DBGET integrated database retrieval system