KEGG   Photorhabdus luminescens: plu2496Help
Entry
plu2496           CDS       T00149                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
plu  Photorhabdus luminescens
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    plu2496 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    plu2496 (adhE)
   00620 Pyruvate metabolism
    plu2496 (adhE)
   00650 Butanoate metabolism
    plu2496 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    plu2496 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    plu2496 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    plu2496 (adhE)
   00626 Naphthalene degradation
    plu2496 (adhE)
Enzymes [BR:plu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     plu2496 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     plu2496 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
2937962..2940595
Genome map
AA seq 877 aa AA seqDB search
MTVTHVTELNELVARVKKAQREFANFSQEQVDKIFRAAALAAADARIPLAKLAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGILSEDKTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIILSPHPRAKKATTKAAELVLSAAVAAGAPKDIIGWIDEPSVELSNA
LMHHQDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDESADIKRAVASILMSKTF
DNGVICASEQSVIVVDEIYDQVRKRFFTHGGYLLQGKELKAVQDIILKNGSLNAEIVGQS
ATKIAEMAGINVPEKTKILIGEVSLTDEAEPFAHEKLSPLLAMYRGNSFEDAVEKAEKLV
EMGGIGHTSCLYTDQDNQAARIKYFGDKMKTARILVNTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINTKTVAKRAENMLWHKLPKSIYFRRGSLPVALEEVATDGAK
RAFIVTDRFLFNHGYADQVTDVLKSHGIETEVFFEVEADPTLSTVRKGAEQMHSFKPDII
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYRFPKMGVKAKMVAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYELTPNIAIVDANLVMDMPKSLCAFGGLDAITHALE
AYVSVLANEYSDGQALQALKLLKEFLPTSYHEGATNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSATGDHTVTKIEKLLAWLKELKSELGIPTSIREAGVQEADFLAKIDKLSEDAFDDQ
CTGANPRYPLISELKQLLLDSYYGREFTETVATEKSQ
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgactgtaactcatgttactgaactgaacgaactcgttgctcgggtaaaaaaagcacaa
cgtgaatttgctaacttttctcaggagcaagttgacaaaatcttccgcgcagcagccctt
gcagcggcagatgcacgtatccctttagcaaaattagccgtagcagaatccggtatgggc
attgtcgaagacaaagtaatcaaaaaccactttgcttccgaatatatctataacgcttat
aaagatgagaaaacctgcggcattttgtctgaggataaaacattcggcaccatcactatc
gccgaacctattggcttaatctgcggtatcgtgccaaccactaacccaacatctaccgct
atttttaaggccctcatcagcctaaaaacccgtaacggcattattctctcaccccaccca
cgcgccaaaaaagcaacaaccaaagcagcagaattggttctatccgctgcggttgccgcg
ggtgcgccaaaagatattattggctggattgatgaaccctccgttgaactttccaatgca
ttgatgcaccaccaagacatcaatctcatcctggcaaccggaggcccaggtatggtaaaa
gcggcatacagctctggtaagcccgcaatcggcgtcggtgccggtaacaccccggttgtc
attgatgaatcagctgatattaaacgcgctgttgcatctattctgatgtctaaaaccttt
gacaacggcgtcatctgcgcttcagaacaatccgttatcgtggtggatgaaatttatgat
caggtgcgtaaacgtttctttactcatggcggttatctgttacaaggcaaggaactgaaa
gctgttcaagatatcattctgaaaaacggtagtctaaatgcggaaatcgttggtcaatct
gcaacaaaaattgccgaaatggcaggcattaatgttcctgaaaagaccaagatcttgatt
ggagaagtgagcttaactgatgaagcagaaccctttgctcacgaaaaattgtctccactg
ctcgctatgtatcgtggtaatagctttgaagatgccgtagaaaaggcagaaaaattggtt
gaaatgggcggaattggtcacacttcttgcttgtataccgatcaggacaatcaagccgca
cgaatcaagtattttggcgataaaatgaaaacagctcgtattctcgtgaatactcctgct
tctcagggcggtatcggtgatctctataacttcaagcttgccccctctctgacactaggc
tgcggctcttggggaggaaattccatctctgaaaatgtagggcccaaacatctcatcaat
accaaaaccgtggcgaaaagagcagaaaatatgctgtggcataaacttccgaaatccatt
tacttccgtcgcggctccctgcctgtggcattagaagaagttgcaaccgacggtgcaaaa
cgcgcttttatcgtaacagaccgtttcttatttaatcatggttatgctgatcaagtcact
gatgtgctgaaatcccacgggatagaaacagaagttttctttgaagttgaagcagaccct
accctaagcactgttcgtaagggtgcggaacaaatgcactcattcaaaccggacatcatt
attgctctggggggagggtccccaatggatgcggccaaaattatgtgggtgatgtatgaa
caccctgaaacgcatttcgaagagctagctctacggtttatggatatccgtaaacgcatc
tatagattccccaaaatgggggttaaagcgaaaatggtcgccattaccacaacttccggc
acaggttctgaagtgacaccatttgcggttgtcactgatgatgcaaccggccagaaatat
ccactggctgattatgaattgacgcctaatatagctattgttgatgccaatctagtcatg
gatatgccgaaatcactctgtgcttttggtgggctggatgcaatcactcacgctttagaa
gcttatgtatcagtcttagcaaacgaatactctgacggacaagcactgcaagcgctaaaa
ctactgaaagagttcctcccaaccagctatcatgaaggggccacgaacccagttgcccgt
gaacgggttcataatgcagcaactattgcagggattgcatttgctaatgccttcttgggg
gtatgccactctatggcgcataaactgggttctgagttccatatcccgcatggcttggct
aacgcattgctgatttgtaacgttatccgctataacgctaacgataacccaaccaaacag
actgcattcagtcaatatgatcgcccacaggcccgccgtcgttacgctgaaattgccgat
catcttggtttatcggctacgggtgaccatactgtcacaaaaattgaaaaactgttagcc
tggctgaaagagctcaagtctgagctaggtatcccgacatctatccgtgaagcgggcgtt
caagaagctgactttctggcaaaaattgataagttatctgaagatgccttcgacgaccaa
tgtaccggtgctaacccacgctacccgctgatttctgagctaaaacaattgctgttggat
tcatactatggacgagaattcacagaaaccgttgcaacagaaaaaagccaataa

DBGET integrated database retrieval system