KEGG   Photorhabdus luminescens: plu2501Help
Entry
plu2501           CDS       T00149                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
plu  Photorhabdus luminescens
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    plu2501 (galU)
   00052 Galactose metabolism
    plu2501 (galU)
   00500 Starch and sucrose metabolism
    plu2501 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    plu2501 (galU)
Enzymes [BR:plu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     plu2501 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(2945181..2946173)
Genome map
AA seq 330 aa AA seqDB search
MPLVNEPLVEKSLVEKVSVEKTSVEKTSVEKIVKKAVIPVAGLGTRMLPATKAIPKEMLP
LVDKPLIQYVVNECIAAGINEIILVTHSSKNSIENHFDTSFELEAILEKRVKRQLLDEVQ
SICPSHVTIMQTRQGIAKGLGHAVLCAKPLIGDEPFAVILPDVILDEYSTDLTRYNLSEM
LVRYNETGASQILVEPVPHEEVSSYGIVDCQGENLQPGDSKLIKRVVEKPKPKEAPSNLS
IVGRYVLSEKIWPLLAKTAPGAGDEIQLTDAIAMLIEREPVEAYHLQGVSHDCGNKLGYM
QAFVRYGMKHHALGKEFTDWLVALQDQVKE
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgccattagtaaacgaaccattagtagaaaaatcattagtagaaaaagtatcagtagaa
aaaacatcagtagaaaaaacatcagtagaaaaaatagtaaaaaaagccgttattcccgtt
gcgggcttgggaacgaggatgttgcctgctacgaaagcaattcctaaagagatgttgcct
ttagtagataaacctcttattcagtatgttgttaatgaatgtattgccgctgggattaat
gaaattatcttggtgactcattcatcaaaaaattcaattgaaaaccattttgataccagt
tttgagttagaagctatccttgagaaaagggtgaagcgtcaattattggacgaagttcaa
tctatttgtccaagtcatgtcaccatcatgcaaactcgtcagggaattgctaaaggatta
gggcatgcggtgttatgtgccaagcctttaatcggtgatgaaccttttgctgtgatactg
cctgatgttattcttgatgaatacagtacagatctgaccagatataatctaagcgaaatg
ttggttcggtataatgaaacgggcgcgagtcaaatattagtagaacctgtacctcatgaa
gaagtttctagttatggtattgtcgattgtcagggggaaaatcttcaacccggtgacagc
aaactcattaagcgcgtggttgaaaaacctaaaccgaaagaagcaccatcaaatctttct
attgttggccgttacgtattgtccgagaaaatttggccgttattagcaaaaacagcgccc
ggtgccggtgatgaaattcaacttactgatgcaatcgctatgttaatagaaagggaacct
gtggaagcctatcatttgcagggtgtaagccatgattgcggtaataagcttggttatatg
caggcatttgtccggtatggtatgaaacatcatgctttgggcaaagaatttacggattgg
ttagtggcgttgcaggatcaggttaaagaataa

DBGET integrated database retrieval system