KEGG   Photorhabdus luminescens: plu2793Help
Entry
plu2793           CDS       T00149                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
plu  Photorhabdus luminescens
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:plu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3316907..3317611
Genome map
AA seq 234 aa AA seqDB search
MPTVEPGDLEVATHGFADGISMQLAKKRALHGPNEVLTKTELNLIIDEAAISFGEFLTAL
GVDWKNDPNSKDTPRRVAKAYVLDLWKGRYKPMGPITTFPADNYDGIVFDGWIALDSMCS
HHHQAISGYVHVAYMPSQYGRVLGLSKLNRIVEHFGRRGLIQERLTAAIHNAVNQVCERN
QGVAVLVDASHNCVRCRGVRHQRSRMKTQMFSGAFAEADSPAKQEFYELIRGIA
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgccgacggtggagccaggagacttggaagttgccacacatggatttgccgatggaata
tccatgcaattagcaaaaaagcgcgcattacacggacccaatgaggttctaaccaaaaca
gaacttaaccttattatagatgaagctgctatatcattcggagaattcctgactgctctt
ggcgttgactggaaaaatgatcctaactcaaaagacacgccgagacgtgttgcaaaggct
tatgttcttgacctatggaaaggccgatacaaaccaatgggacccatcactacatttccg
gcagataactacgatggcattgtattcgacggctggatagcgctcgattccatgtgctct
caccatcatcaagcaatcagtggctatgttcacgttgcctatatgccaagtcaatacggg
cgtgttcttggcttgtcaaagttaaaccgaatagtcgaacatttcggcagacgtgggctc
atacaagaacggttaacagcagcaatccacaatgcagtaaaccaagtatgtgaaagaaac
caaggcgtcgcagtattagtcgatgcatcgcacaattgtgtacgttgcagaggtgtacgc
caccagagaagccgtatgaagacacaaatgttttcaggtgcattcgctgaagctgattca
ccggcaaaacaagagttctatgaattgattagaggtattgcatga

DBGET integrated database retrieval system