KEGG   Photorhabdus luminescens: plu2799Help
Entry
plu2799           CDS       T00149                                 

Definition
hypothetical protein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
plu  Photorhabdus luminescens
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    plu2799
Enzymes [BR:plu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     plu2799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3325286..3325828
Genome map
AA seq 180 aa AA seqDB search
MKHEKVIAAVAIGSNLSQPYYNLLTAENHLLALKESTNFRFSPIYKTAPIDSTGAPDYLN
AVVVFETSLTPVVLLTELLSIETLNGRKRSFVNAPRTLDLDLLLYGDKVISTENLIVPHP
RFHKRFFVLTPLNDLLPETQHPLLKASINELEQRLQTLYEKEKYISHFDQTFRSVSTNIH
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacgaaaaagtcatagcagcagtagcaattggaagtaatcttagtcagccttat
tacaacttgttaacagcagaaaatcatttgctggcattgaaggaaagtacaaacttccga
tttagtccgatatataaaacagcaccgattgacagtacaggagcaccagactacttgaat
gccgttgttgtctttgaaacatcgctaacaccggtcgttttgctcaccgaattgctaagt
attgaaactctcaacggcaggaaacgctcgtttgtcaatgctcctcgaacgctggatctt
gatttactcttatacggagacaaggttatatctacggagaacctgattgttcctcatccg
aggtttcataagcgcttctttgttttgacaccactcaatgacttattacctgaaacacaa
catccactccttaaagcatcgattaatgaacttgagcaaagattgcaaacactgtatgaa
aaagagaaatatatatctcatttcgaccaaacatttcgatctgtttctactaacattcat
tag

DBGET integrated database retrieval system