KEGG   Photorhabdus luminescens: plu3103Help
Entry
plu3103           CDS       T00149                                 

Definition
hypothetical protein
Orthology
K04487  
cysteine desulfurase [EC:2.8.1.7]
Organism
plu  Photorhabdus luminescens
Pathway
Thiamine metabolism
Sulfur relay system
Class
Metabolism; Metabolism of cofactors and vitamins; Thiamine metabolism [PATH:plu00730]
Genetic Information Processing; Folding, sorting and degradation; Sulfur relay system [PATH:plu04122]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(3622091..3623257)
Genome map
AA seq 388 aa AA seqDB search
MGVAMNVNENPTGVIYLDHCATTPCFPEVVDIMRFYMEHEFGNSSSAHVMGRRARHAIEN
AAQQVASLIGARPEEIAFTSGATEANNIALFSSFAHNECAPAGALLCPIDHKSVLLVGKE
LSRRGLAVEYLPVAANGRVQPEDVITKLTADTRIVSVAHVNSELGTVQPVDEIAAITRRS
GAWLHVDAVQSIGKIPVNVKETGIDMLSFSAHKMRGPKGVGALFVDARVAGHLRPFIYGG
GQNHLRSGTLPTPLIVGFGLACQMIQSTLIQRQAKVTALRDYFITRLHQRVPNAVLNTDI
SCSSPYIVNVQFEGIASEALISGLHQVAISSGSACNSAELQPSHVLTGIGLSSAQANASV
RFCFDPDLDNAILDTAIEHLVFRLNSIR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgggagtcgctatgaatgtcaatgaaaacccgactggcgtaatctatctggatcattgt
gctacgacaccatgctttcctgaggtcgtcgacatcatgcgattctacatggagcatgaa
ttcggtaattcttcctccgcccatgtgatgggacgtcgtgcccggcatgcgatagagaac
gccgcccaacaagttgcgtctctcatcggtgctcgcccagaggagattgcctttacatcg
ggggccacagaagccaacaatattgcgcttttctcaagttttgctcataacgaatgcgct
cctgcgggagcgctgctttgccctatcgaccacaaatctgtgttgcttgtcggcaaagag
ttgagtcgtcgggggcttgctgttgaatacctgccggttgccgccaatggccgggtacaa
ccggaagatgtcatcaccaaattgaccgccgacacccgtatcgtcagcgttgctcatgtg
aattccgaattaggtacagttcagccggtggatgaaattgccgcgatcacacgtcggtca
ggcgcttggctacatgtggatgctgtccagtctatcggcaaaattcccgtgaacgtcaaa
gagactggaattgatatgctttcattttccgcccacaaaatgcggggaccgaaaggagtt
ggggcgctcttcgtcgatgcgcgtgttgcggggcatttgaggcccttcatctatggtggc
ggccagaatcatttgcgcagcggcaccttgccaacgccgctgattgttgggtttggcctt
gcgtgtcagatgattcagtcaacccttattcaacgtcaagcaaaagtcactgcattgaga
gactattttattactcgccttcatcaaagggtgccgaacgccgtgttgaataccgatatc
tcttgcagttccccatacatcgtgaacgttcagttcgaaggtatcgcttcggaggcgcta
atatccgggttgcatcaggtggctatatcgtcaggttcagcctgcaattccgcggaacta
cagccttcgcacgtgcttacaggcatcggcttgagctcggctcaggctaatgcgtcggtt
cggttctgttttgatccggatctcgataatgcgatattggacaccgcaattgaacacctt
gtcttccgattaaattctattcgctag

DBGET integrated database retrieval system