KEGG   Photorhabdus luminescens: plu3103Help
Entry
plu3103           CDS       T00149                                 

Definition
hypothetical protein
Orthology
K04487  
cysteine desulfurase [EC:2.8.1.7]
Organism
plu  Photorhabdus luminescens
Pathway
Thiamine metabolism
Metabolic pathways
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    plu3103
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    plu3103
Enzymes [BR:plu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     plu3103
Transfer RNA biogenesis [BR:plu03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    plu3103
 Prokaryotic Type
    plu3103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(3622091..3623257)
Genome map
AA seq 388 aa AA seqDB search
MGVAMNVNENPTGVIYLDHCATTPCFPEVVDIMRFYMEHEFGNSSSAHVMGRRARHAIEN
AAQQVASLIGARPEEIAFTSGATEANNIALFSSFAHNECAPAGALLCPIDHKSVLLVGKE
LSRRGLAVEYLPVAANGRVQPEDVITKLTADTRIVSVAHVNSELGTVQPVDEIAAITRRS
GAWLHVDAVQSIGKIPVNVKETGIDMLSFSAHKMRGPKGVGALFVDARVAGHLRPFIYGG
GQNHLRSGTLPTPLIVGFGLACQMIQSTLIQRQAKVTALRDYFITRLHQRVPNAVLNTDI
SCSSPYIVNVQFEGIASEALISGLHQVAISSGSACNSAELQPSHVLTGIGLSSAQANASV
RFCFDPDLDNAILDTAIEHLVFRLNSIR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgggagtcgctatgaatgtcaatgaaaacccgactggcgtaatctatctggatcattgt
gctacgacaccatgctttcctgaggtcgtcgacatcatgcgattctacatggagcatgaa
ttcggtaattcttcctccgcccatgtgatgggacgtcgtgcccggcatgcgatagagaac
gccgcccaacaagttgcgtctctcatcggtgctcgcccagaggagattgcctttacatcg
ggggccacagaagccaacaatattgcgcttttctcaagttttgctcataacgaatgcgct
cctgcgggagcgctgctttgccctatcgaccacaaatctgtgttgcttgtcggcaaagag
ttgagtcgtcgggggcttgctgttgaatacctgccggttgccgccaatggccgggtacaa
ccggaagatgtcatcaccaaattgaccgccgacacccgtatcgtcagcgttgctcatgtg
aattccgaattaggtacagttcagccggtggatgaaattgccgcgatcacacgtcggtca
ggcgcttggctacatgtggatgctgtccagtctatcggcaaaattcccgtgaacgtcaaa
gagactggaattgatatgctttcattttccgcccacaaaatgcggggaccgaaaggagtt
ggggcgctcttcgtcgatgcgcgtgttgcggggcatttgaggcccttcatctatggtggc
ggccagaatcatttgcgcagcggcaccttgccaacgccgctgattgttgggtttggcctt
gcgtgtcagatgattcagtcaacccttattcaacgtcaagcaaaagtcactgcattgaga
gactattttattactcgccttcatcaaagggtgccgaacgccgtgttgaataccgatatc
tcttgcagttccccatacatcgtgaacgttcagttcgaaggtatcgcttcggaggcgcta
atatccgggttgcatcaggtggctatatcgtcaggttcagcctgcaattccgcggaacta
cagccttcgcacgtgcttacaggcatcggcttgagctcggctcaggctaatgcgtcggtt
cggttctgttttgatccggatctcgataatgcgatattggacaccgcaattgaacacctt
gtcttccgattaaattctattcgctag

DBGET integrated database retrieval system