KEGG   Photorhabdus luminescens: plu3200Help
Entry
plu3200           CDS       T00149                                 

Definition
(GenBank) unnamed protein product; Similar to putative fatty oxidation complex alpha subunit [Includes: Enoyl-CoA hydratase; 3-hydroxyacyl-CoA dehydrogenase; 3-hydroxybutyryl-CoA epimerase ] YfcX of Escherichia coli
  KO
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
plu  Photorhabdus luminescens
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    plu3200
   01212 Fatty acid metabolism
    plu3200
  Carbohydrate metabolism
   00640 Propanoate metabolism
    plu3200
   00650 Butanoate metabolism
    plu3200
  Lipid metabolism
   00071 Fatty acid degradation
    plu3200
   01040 Biosynthesis of unsaturated fatty acids
    plu3200
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    plu3200
   00310 Lysine degradation
    plu3200
   00380 Tryptophan metabolism
    plu3200
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    plu3200
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    plu3200
   00281 Geraniol degradation
    plu3200
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    plu3200
   00930 Caprolactam degradation
    plu3200
Enzymes [BR:plu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     plu3200
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     plu3200
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     plu3200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
complement(3764441..3766672)
Genome map
AA seq 743 aa AA seqDB search
MCCWRVGHSYGIGGGIMTQAQHDAAPITTGTNQTASVFSFDVRPDKIGIITINVPGEKVN
TLKAEFVDQFLNVFKQAQQSSGLKGLILISGKPDTFIAGADISMIAGCKTKEDARDLAEK
GQKLFSQIANYPLPVVAAIHGACLGGGLELALACHWRVCSQDDKTRLGLPEVQLGLLPGS
GGTQRLPRLIGVSSALDIMLTGKQLRAKQALRLGLVDDAVPLDILLDIAIEKVKKGIPVR
KPLPWQQRLLVGPVGRYFLFNIVRKKTLAKTRGHYPAPERIIEVVKEGLEKGMSQGLRAE
AVAFGELAMTRESAALRNLFFAATSLKNETGSSEKPAKIKHVGILGGGLMGGGIANVTAT
RGKLPVRIKDINEKGISQVLKYTWDLLSKRVKQKRLRPAERAQQMMLISGTTDYRGFAQT
DIVVEAVFEDLSLKQKMVAEIETNAKPETIFASNTSSLPIHQIAEKAQRPEQVIGLHYFS
PVDKMPLVEVIPHQGTSEKTIATAVSLAKKQGKTAIVVGDKAGFYVNRILVPYISEAAHC
LVAGEPIDHIDGALVNFGFPVGPINLLDEVGIDVGTKIMPVLVEQLGPRFAAPESLDAVL
KDGRKGRKNGRGFYLYAPGPRKFWQFGKRDKKVDSSVYTLLNITPESHMLSSEIAQRCVM
LMLNEAVRCLDEGIIRSPRDGDIGAVFGIGFPPFFGGPFRYIDSLGCARVVEILRRLESQ
YGDRFVPCECLVNMAEQNKSFYP
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
ttgtgctgctggcgggttgggcacagctatggtattggaggtggaataatgactcaagct
cagcatgatgctgcacccatcactacgggtacaaaccaaactgcttctgttttcagtttt
gacgtcaggccagataagataggcatcatcaccattaatgtaccgggagaaaaggtcaat
acgctgaaagcagaatttgttgatcaatttctgaatgttttcaagcaagctcagcaatct
tctggtcttaaaggattaatattgatttccggtaaaccggatacgtttattgccggtgct
gatatttctatgattgccggatgtaagaccaaagaagatgcgcgagatttggctgaaaaa
ggtcagaaactattttctcagatagccaattaccctttgcctgtcgtagcagcaattcat
ggcgcttgtttggggggcggtttggaattggcgcttgcatgtcattggcgtgtatgttca
caggatgataaaactcgtcttggattaccggaagttcaacttgggttattacctggctct
ggtggtactcagcggttgccaaggcttattggtgttagttcagcgttggatatcatgctg
acaggtaaacagctacgggcgaaacaggcattacggctcggattggtggatgatgctgtg
ccgttggatattttgctggatattgctatcgaaaaagtcaaaaagggtattcctgtgcgt
aagcctttgccgtggcaacagcggctattagttggccccgtcggaagatactttttgttt
aatatcgttcgtaaaaagacactggcgaaaactcgtggacattatcctgcacctgaacga
attattgaagttgtcaaagaaggtcttgaaaaaggtatgagccagggtttacgggctgag
gcggtggcatttggtgaattggcaatgacacgggaatctgctgctttacgtaatctgttt
tttgctgcaacttcgttgaagaatgaaacggggtcatcagagaagccggcgaagatcaag
cacgttggtatattaggtggtggtttgatgggtggaggcattgccaatgtaacagccacc
cgaggcaaactaccggtgcggattaaagatattaatgaaaagggcattagtcaggtattg
aaatatacttgggatttgttgtccaagcgggtgaagcaaaaacgactacgcccggcagag
cgtgctcaacaaatgatgctgatttcaggaacgacggattatcgtggtttcgcacaaact
gatattgttgttgaagcagtgtttgaggatttgtcactaaagcagaaaatggtggcagaa
attgaaacgaatgctaaaccagaaaccatatttgcatctaatacctcttcactacctatc
catcagattgctgaaaaagctcaacgaccagagcaggttattggtctgcattattttagt
ccagtggataagatgccgctggtggaagttattccacatcaagggaccagtgagaaaacg
attgctacagccgtttctttggcgaagaagcagggtaaaaccgcgatcgtggtgggtgat
aaagccgggttttatgtaaaccggattcttgttccttatatcagtgaagccgcgcattgc
ttggtagcaggagaacctattgaccatatcgatggagctctggttaattttggttttccg
gtagggccgattaatttattggatgaagtaggtattgacgttggcaccaaaatcatgcca
gttctggtagaacaattaggcccgcgttttgctgcacctgaatctctcgatgctgtactg
aaagatggtcgtaagggtaggaaaaatggccgtggtttctatttatatgccccagggccc
agaaaattctggcagtttggtaagagagacaaaaaagttgatagctcagtgtataccttg
ctgaatataacgcctgagtcgcatatgctctcgtcagaaattgctcaacgttgtgtgatg
ctaatgcttaatgaagctgttcgttgcttggatgaaggcattatcagaagtccacgtgat
ggtgatattggggcggtatttggcattggttttccgccattctttggtggtccattccgt
tatattgatagccttggttgtgccagagtggtggagattctgcgcaggctggaaagccag
tatggagacagatttgtaccttgtgagtgtttagtgaatatggctgaacagaataaaagt
ttttatccatag

DBGET integrated database retrieval system