KEGG   Photorhabdus luminescens: plu3200Help
Entry
plu3200           CDS       T00149                                 

Gene name
fadJ
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17 5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
plu  Photorhabdus luminescens
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    plu3200 (fadJ)
   01212 Fatty acid metabolism
    plu3200 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    plu3200 (fadJ)
   00650 Butanoate metabolism
    plu3200 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    plu3200 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    plu3200 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    plu3200 (fadJ)
   00310 Lysine degradation
    plu3200 (fadJ)
   00380 Tryptophan metabolism
    plu3200 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    plu3200 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    plu3200 (fadJ)
   00281 Geraniol degradation
    plu3200 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    plu3200 (fadJ)
Enzymes [BR:plu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     plu3200 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     plu3200 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     plu3200 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(3764441..3766624)
Genome map
AA seq 727 aa AA seqDB search
MTQAQHDAAPITTGTNQTASVFSFDVRPDKIGIITINVPGEKVNTLKAEFVDQFLNVFKQ
AQQSSGLKGLILISGKPDTFIAGADISMIAGCKTKEDARDLAEKGQKLFSQIANYPLPVV
AAIHGACLGGGLELALACHWRVCSQDDKTRLGLPEVQLGLLPGSGGTQRLPRLIGVSSAL
DIMLTGKQLRAKQALRLGLVDDAVPLDILLDIAIEKVKKGIPVRKPLPWQQRLLVGPVGR
YFLFNIVRKKTLAKTRGHYPAPERIIEVVKEGLEKGMSQGLRAEAVAFGELAMTRESAAL
RNLFFAATSLKNETGSSEKPAKIKHVGILGGGLMGGGIANVTATRGKLPVRIKDINEKGI
SQVLKYTWDLLSKRVKQKRLRPAERAQQMMLISGTTDYRGFAQTDIVVEAVFEDLSLKQK
MVAEIETNAKPETIFASNTSSLPIHQIAEKAQRPEQVIGLHYFSPVDKMPLVEVIPHQGT
SEKTIATAVSLAKKQGKTAIVVGDKAGFYVNRILVPYISEAAHCLVAGEPIDHIDGALVN
FGFPVGPINLLDEVGIDVGTKIMPVLVEQLGPRFAAPESLDAVLKDGRKGRKNGRGFYLY
APGPRKFWQFGKRDKKVDSSVYTLLNITPESHMLSSEIAQRCVMLMLNEAVRCLDEGIIR
SPRDGDIGAVFGIGFPPFFGGPFRYIDSLGCARVVEILRRLESQYGDRFVPCECLVNMAE
QNKSFYP
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagctcagcatgatgctgcacccatcactacgggtacaaaccaaactgcttct
gttttcagttttgacgtcaggccagataagataggcatcatcaccattaatgtaccggga
gaaaaggtcaatacgctgaaagcagaatttgttgatcaatttctgaatgttttcaagcaa
gctcagcaatcttctggtcttaaaggattaatattgatttccggtaaaccggatacgttt
attgccggtgctgatatttctatgattgccggatgtaagaccaaagaagatgcgcgagat
ttggctgaaaaaggtcagaaactattttctcagatagccaattaccctttgcctgtcgta
gcagcaattcatggcgcttgtttggggggcggtttggaattggcgcttgcatgtcattgg
cgtgtatgttcacaggatgataaaactcgtcttggattaccggaagttcaacttgggtta
ttacctggctctggtggtactcagcggttgccaaggcttattggtgttagttcagcgttg
gatatcatgctgacaggtaaacagctacgggcgaaacaggcattacggctcggattggtg
gatgatgctgtgccgttggatattttgctggatattgctatcgaaaaagtcaaaaagggt
attcctgtgcgtaagcctttgccgtggcaacagcggctattagttggccccgtcggaaga
tactttttgtttaatatcgttcgtaaaaagacactggcgaaaactcgtggacattatcct
gcacctgaacgaattattgaagttgtcaaagaaggtcttgaaaaaggtatgagccagggt
ttacgggctgaggcggtggcatttggtgaattggcaatgacacgggaatctgctgcttta
cgtaatctgttttttgctgcaacttcgttgaagaatgaaacggggtcatcagagaagccg
gcgaagatcaagcacgttggtatattaggtggtggtttgatgggtggaggcattgccaat
gtaacagccacccgaggcaaactaccggtgcggattaaagatattaatgaaaagggcatt
agtcaggtattgaaatatacttgggatttgttgtccaagcgggtgaagcaaaaacgacta
cgcccggcagagcgtgctcaacaaatgatgctgatttcaggaacgacggattatcgtggt
ttcgcacaaactgatattgttgttgaagcagtgtttgaggatttgtcactaaagcagaaa
atggtggcagaaattgaaacgaatgctaaaccagaaaccatatttgcatctaatacctct
tcactacctatccatcagattgctgaaaaagctcaacgaccagagcaggttattggtctg
cattattttagtccagtggataagatgccgctggtggaagttattccacatcaagggacc
agtgagaaaacgattgctacagccgtttctttggcgaagaagcagggtaaaaccgcgatc
gtggtgggtgataaagccgggttttatgtaaaccggattcttgttccttatatcagtgaa
gccgcgcattgcttggtagcaggagaacctattgaccatatcgatggagctctggttaat
tttggttttccggtagggccgattaatttattggatgaagtaggtattgacgttggcacc
aaaatcatgccagttctggtagaacaattaggcccgcgttttgctgcacctgaatctctc
gatgctgtactgaaagatggtcgtaagggtaggaaaaatggccgtggtttctatttatat
gccccagggcccagaaaattctggcagtttggtaagagagacaaaaaagttgatagctca
gtgtataccttgctgaatataacgcctgagtcgcatatgctctcgtcagaaattgctcaa
cgttgtgtgatgctaatgcttaatgaagctgttcgttgcttggatgaaggcattatcaga
agtccacgtgatggtgatattggggcggtatttggcattggttttccgccattctttggt
ggtccattccgttatattgatagccttggttgtgccagagtggtggagattctgcgcagg
ctggaaagccagtatggagacagatttgtaccttgtgagtgtttagtgaatatggctgaa
cagaataaaagtttttatccatag

DBGET integrated database retrieval system