KEGG   Photorhabdus luminescens: plu3414Help
Entry
plu3414           CDS       T00149                                 

Definition
hypothetical protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
plu  Photorhabdus luminescens
Brite
Enzymes [BR:plu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     plu3414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(4033420..4033956)
Genome map
AA seq 178 aa AA seqDB search
MTKTSKLSAAVIGLVLSGAGATAILSQFLDEKEGNRLSAYQDAGGVWTICRGVTRIDGTP
ARQGMRLMPNQCRDLNAQEAKQAIAWVKRNVRVPLTEPQIAGIASFCPYNIGPSKCFSST
FYRKLNAGDKKGACAEIKRWVFDNGRDCRQTKGQANGCYGQVERRAQESELTCWGLDE
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaccagtaagttaagtgctgcggttatcggtctggttctttctggtgcaggt
gccacggcgatattgtctcagttcttggacgagaaagagggtaaccggctatcagcgtat
caagatgcggggggagtctggacaatctgccgaggtgttactcggattgatggaactccc
gctcgtcaggggatgaggttaatgccgaatcagtgccgtgacctcaatgcacaagaagca
aagcaggctattgcatgggtaaaacgcaatgtgcgggtgccattaactgaacctcagata
gcaggtattgccagcttttgcccatataacattggcccatcgaaatgcttctcttccaca
ttctatagaaagctgaatgccggagataagaaaggcgcttgtgctgagataaaacgttgg
gtatttgataatggtcgagactgtcgacagaccaaagggcaggcaaacggctgttatggt
caagttgagcgacgtgcccaggaatcggaattaacttgctgggggctggatgaatag

DBGET integrated database retrieval system