KEGG   Photorhabdus luminescens: plu3551Help
Entry
plu3551           CDS       T00149                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
plu  Photorhabdus luminescens
Brite
Enzymes [BR:plu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     plu3551 (dsbC)
Secretion system [BR:plu02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   plu3551 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(4186031..4186738)
Genome map
AA seq 235 aa AA seqDB search
MKKSVLCFPLLLAWFSGNALADDGAVHRIMQKLGIKAESIQPSPIVGLNTVVTEQGIIYL
SDDGKYLLQGPIYDVSGSAPVNVSNQLLMKKLEAMRDQMIIYKAPEEKHVVTVFTDITCG
YCHKLHENMKEYNKLGITVRYLAFPRQGMQHQSAKDMQSIWCSATPQKSLDAAFKNEDVS
PIKSCKVDIANQYKLGLQFGVQGTPAIVLKDGSLLGGYMPPEALAAALAQRGKSV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagcgtgttatgtttccctcttttgctggcctggtttagtggaaatgcgctt
gctgatgatggtgctgtccatagaataatgcaaaaactagggataaaagcagaaagcatc
cagccatcacctatcgttggtttaaatacggtagtgactgagcaaggtatcatttatcta
tctgatgacgggaaatatttattacaagggccaatttatgatgttagtggtagcgctcct
gtgaatgtcagtaatcaattattgatgaaaaagctggaagcaatgagagatcaaatgatc
atctacaaggcgccagaagagaagcatgtcgttaccgttttcacggatattacctgtggt
tactgccataaattgcatgaaaacatgaaagagtacaataaactgggtattactgtgcgc
tatttggcattccctcgtcagggtatgcagcaccaatctgctaaagatatgcaatctatc
tggtgtagtgcaacaccgcagaaatcattagatgctgcgtttaaaaatgaagatgtttcg
ccaattaagagctgtaaggtggatattgctaaccagtacaaattaggtctccagtttggt
gtgcagggaacgccggcaattgtccttaaggatggcagcctgttaggtggatatatgcca
ccagaggctttggcagcggcactggcgcaacgtggtaaatcagtttag

DBGET integrated database retrieval system