KEGG   Photorhabdus luminescens: plu3818Help
Entry
plu3818           CDS       T00149                                 

Gene name
tesA
Definition
multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
plu  Photorhabdus luminescens
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:plu01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
4486777..4487412
Genome map
AA seq 211 aa AA seqDB search
MLNFKNIPRYHLLFLLLMVLFSARATAADTLLILGDSLSAGYHLPIEQSWPALMEKKWQK
SGNKITVINGSISGNTAAQGLERLPELLKQHKPRWVLIELGANDGLRGFPPQHTEQDLQQ
IITLVKQANIQPLLMQIRLPPNYGRRYTESFAKIYPKLAEYNQIPLLPFYMEQVAIKPEW
VQQDGLHPNLAAQPFIADWMSDTLSAHLNYS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacttcaagaatattccccgttaccatttacttttccttttactgatggtgcta
tttagcgccagagcgactgcggctgatacccttctgattctcggtgatagccttagtgcc
ggttaccatctgcctattgagcagtcatggcctgctttgatggaaaaaaagtggcaaaaa
tccggcaataaaatcacggtcatcaacggcagcatcagcggcaacaccgccgctcagggc
cttgagcggctacctgaattacttaaacaacataaaccccgttgggtactgatagagctg
ggtgccaacgatggattacgcggttttcctccacaacacaccgaacaagatctacaacag
atcattactttagtgaaacaagctaatattcagcctttattgatgcagatccgtctacca
ccaaactatgggcgccgttataccgagtcttttgccaagatttaccccaaactggcagaa
tataatcaaattcccctgctcccgttttatatggagcaagtcgccattaaaccggagtgg
gtgcaacaagatgggttacatcctaatctggcagcccaaccatttatcgccgattggatg
tctgacacactatcagcacatcttaattattcttaa

DBGET integrated database retrieval system