KEGG   Photorhabdus luminescens: plu4143Help
Entry
plu4143           CDS       T00149                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
plu  Photorhabdus luminescens
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    plu4143
Enzymes [BR:plu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     plu4143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(4842062..4843321)
Genome map
AA seq 419 aa AA seqDB search
MKDRVNLRYRVHPGLRYDPVEPGRIEISIPLGTKRLRVSSKIRSLLEQIKSEAVLVGTII
VQRLGISVFEAMVKYHFLFPEDASTALEGGLCIPVSEPAGQSISVFDFDELQADDAVLLH
APILTTTGGEISVAGGGQHVRSQLVQCLRHPLGTAGKGVLLDLDFGTRLEPERLCLFDLG
DIVYRPSMDSATDVGERLTYVCRNIVEWDACPIILGGDHAQAFYSISALSERYPRLGVLQ
FDAHPDLYAMGTPCDLQLSHANVMHWVRRMPHVASIWQIGIRDYFCQPTENLQLEVDPKF
HMLSAFEAETVGYERLFRNMDRSLPWFISFDVDVLFGTEVPQTATPVLGGLNYYPLLACF
ERLLSEFRIVGMEFVEIGDASQGAHGAAAVAARLLSRYLFHLSKAMVAGHCIYSPFHQR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatcgcgtaaaccttagataccgtgttcaccctggcctgcgctacgatcctgtt
gaacctgggcgtatagagatcagtattcccctaggcactaagcgactgcgtgtgtctagt
aaaataagatcattattggaacaaataaagtcagaggctgttctggtcggaacaattata
gtccagcgtctggggatttctgtgtttgaggctatggtgaagtaccattttctgtttccg
gaagatgcgagtaccgccttggaaggcggactttgtatacctgtttcggaaccggcggga
cagtcaattagcgtctttgattttgatgaactccaggccgatgatgccgtgttattacat
gctcctatcttgacgacaactggaggagagatatcggttgcaggtggtggtcaacacgtg
cgttcccagttggtacagtgcttgagacatcctctgggtacagcgggaaagggtgtttta
ctggaccttgatttcggtactcggttggagccagaacgtctgtgtctgttcgatctcggt
gatatcgtataccgccctagtatggatagtgctaccgatgttggtgaacggcttacctat
gtgtgccgtaatattgtggagtgggatgcatgtccaataatcctagggggagatcatgcc
caagctttctacagcataagtgctttaagcgagcgttatccacgtctgggggtgttgcag
tttgatgctcatcctgatttgtatgctatggggactccctgcgatttgcagcttagccat
gctaatgtcatgcactgggttcgtcgtatgccccatgttgcatcaatttggcagattggt
attcgggattatttttgtcaacctactgaaaacctccagttagaagtggatcctaagttc
catatgctctcggcttttgaagcagagaccgtgggctacgagcgcctattcaggaatatg
gatcgttctttaccttggttcattagttttgacgtcgatgtgctgtttggtacggaagta
ccgcagacagcaacccctgtactgggtggcctgaattactatcctctgttggcttgtttt
gagcggctgttaagcgagttccgtattgttggtatggagtttgtcgagattggtgatgct
tcgcaaggtgcccacggggcagccgcagtggctgctcggttgcttagtcgctatctcttc
catttgagtaaggcgatggtggccggccattgtatctattcaccttttcatcaaaggtga

DBGET integrated database retrieval system