KEGG   Photorhabdus luminescens: plu4251Help
Entry
plu4251           CDS       T00149                                 

Gene name
holD
Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
plu  Photorhabdus luminescens
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    plu4251 (holD)
   00240 Pyrimidine metabolism
    plu4251 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    plu4251 (holD)
   03430 Mismatch repair
    plu4251 (holD)
   03440 Homologous recombination
    plu4251 (holD)
Enzymes [BR:plu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     plu4251 (holD)
DNA replication proteins [BR:plu03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     plu4251 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(4973762..4974175)
Genome map
AA seq 137 aa AA seqDB search
MVTRRDRLLAQLGITQWTLRNPTVLQGELAVHLPDTTRLLIITNDHIDLTNSLLIDIFTA
MGLDKSSVYCITTNNVAMLPEQVKCPYWLLGVDITLSWPGISLRSPALNDLYCDGQAKRS
LWQQISQHEQHFSINSR
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggtaacccggcgcgacaggttattagctcaattggggattacccaatggaccttacgt
aaccctacggttttgcaaggtgaattagctgttcacttacctgacaccactcgtctgctg
attattaccaatgaccacattgatttaactaattcattattaatagatattttcaccgct
atggggttggataaatcctctgtttactgcattacaacaaataatgttgcgatgttaccg
gaacaggttaagtgcccatattggttgttaggggtggatattacactatcatggccggga
atttctttgagaagcccggcattaaatgatttatattgtgatggacaggcaaaacgttct
ctttggcaacagatttctcaacatgaacaacatttctctattaactcccgctga

DBGET integrated database retrieval system