KEGG   Photorhabdus luminescens: plu4395Help
Entry
plu4395           CDS       T00149                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase (isocitrase) (isocitratase) (ICL)
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
plu  Photorhabdus luminescens
Pathway
plu00630  Glyoxylate and dicarboxylate metabolism
plu01100  Metabolic pathways
plu01110  Biosynthesis of secondary metabolites
plu01120  Microbial metabolism in diverse environments
plu01200  Carbon metabolism
Module
plu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    plu4395 (aceA)
Enzymes [BR:plu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     plu4395 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase ETC_C1_NDUFA4
Motif
Other DBs
NCBI-ProteinID: CAE16767
Pasteur: plu4395
UniProt: Q7MZ99
Position
complement(5134218..5135525)
Genome map
AA seq 435 aa AA seqDB search
MTISRTQQIAQLEQEWKSDRWNGIIRPYSAEDVVKLRGSVNPEHTLAQLGAKKLWELLHG
MAKKGYVNSLGALTGGQALQQAKAGIEAVYLSGWQVAADANTASSMYPDQSLYPVDSVPA
VVKRINNSFRRADQIQWANGIGTDHQEYIDYFLPIVADAEAGFGGVLNAFELMKAMIEAG
AAAVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVSGVPTLLIARTDADAAD
LLTSDSDAYDSEFITGERTFEGFFRTRAGIDQAISRGLAYAPYADLIWCETSTPDIEMAR
RFAEAIHAKYPGKLLAYNCSPSFNWKKNLDDKTIARFQDELSAMGYKFQFITLAGIHSMW
FNMFDLAHAYAQGEGMKHYVEKVQEREFESINRGYTFSSHQQEVGTGYFDKVTTIIQGGT
SSVTALTGSTEEQQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacaatctccagaactcaacaaatcgctcaactggaacaagaatggaaaagtgaccgt
tggaatgggattattcgcccgtacagtgcggaagatgtggttaaattgcgtggttcggtt
aatccagaacatacattggcacagcttggtgctaaaaaactgtgggaactactgcatggc
atggcaaagaaaggctatgtcaactcattaggtgcattgacgggtgggcaggcattacag
caggcaaaagcgggtattgaggcggtttatctttctggttggcaggttgcggctgatgct
aacactgcatccagtatgtatcctgatcagtccctgtatccggtggattccgtcccggcg
gtggtaaaacgtattaataacagtttccgtcgtgcagatcagattcagtgggcaaatggt
attggtactgatcatcaggaatatatcgattattttctgccaattgtggcggatgcggaa
gccggatttggtggtgttctgaatgcttttgaattgatgaaagctatgattgaagcgggt
gctgcggctgttcactttgaagatcaactggctgcggtgaaaaaatgtggtcatatgggc
ggtaaagttctggttccgacacaagaggcgattcaaaaattggtcgctgcgcgtttggcg
gcggatgtttctggcgtaccgacgctgttgattgctcgtacagatgctgatgcagccgat
ctgttaacctctgacagtgacgcatatgacagtgagtttattaccggagaacggactttt
gaggggttcttccgtaccagagcgggtatcgatcaagcaattagtcgtggtttggcttat
gcgccgtatgctgacttgatatggtgtgaaacatcaacacctgatattgaaatggcccgt
cgttttgctgaggcgattcatgctaaatatcccggtaaattgttagcttacaactgttct
ccatcgttcaattggaaaaaaaatctggatgataagactattgcgcgtttccaggatgaa
ctgtcagcaatgggttataaattccaatttattactctggcgggtatccacagtatgtgg
ttcaacatgttcgacttggcacatgcttacgcgcagggtgaaggcatgaaacattatgtg
gagaaggtccaggaaagagagtttgaatccattaaccgtggttataccttctcttctcat
cagcaggaagttggcacaggttatttcgataaagtcacaacgattattcaagggggaaca
tcgtcagtaaccgcattgacaggttccacagaagagcagcagttctga

DBGET integrated database retrieval system