KEGG   Photorhabdus luminescens: plu4396Help
Entry
plu4396           CDS       T00149                                 

Gene name
aceB
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
plu  Photorhabdus luminescens
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    plu4396 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    plu4396 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    plu4396 (aceB)
Enzymes [BR:plu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     plu4396 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
Position
complement(5135622..5137220)
Genome map
AA seq 532 aa AA seqDB search
MTQQTLATELSFIKRFGAAEQEVLIPEAVDFLKDLVVRFTDARKKLLVERDIWQKKIDDG
ELPDFISETGSIRESEWEIQNIPADLRDRRVEITGPVERKMVINALNANVKVFMADFEDS
LAPAWDKVIEGQINLRDAVNGTISYVNEQGKQYQLQPDPAVLIARVRGIHLPEKHVLYQN
EPIAGGLFDFALYFYHNHKQLLAKGSGPYFYLPKIQSYHEAQWWSDVFSFAEDRFDLPRG
TIKATVLIETLPAVFQMDEILYHLRHHIVGLNCGRWDYIFSYIKTLKNHSDRVLPDRQSV
TMDQPFLNAYSRLLIKTCHKRGAFAMGGMAAFIPSKDIERNNWVLDKVRADKELEARNGH
DGTWIAHPGLADTVMDVFDRVLAERQNQLDIFREEDAPITAAQLLEPCPGDRTEEGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHEKSLSNGKKVTKSLFKQ
MLAEEMEVIKQEVGETRFSQGRFSDAAKLMERITTQDELIDFLTLPGYQLLD
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcaaactttagcgactgaattatcgtttattaaacgatttggagcagcagag
caggaggttttgatacctgaagcggtagattttctgaaagatctggttgttcggtttact
gatgcacggaaaaaattgttagtcgagcgggatatttggcagaagaaaattgatgatggt
gaattgcctgattttatttcggaaaccggttccattcgtgaaagtgaatgggaaattcaa
aatattccagcggatctccgtgatcgcagagtagaaatcactggaccagtagaacggaaa
atggttatcaacgctttgaatgctaacgtaaaagttttcatggcggatttcgaagattcc
ttagcaccagcttgggataaggtgattgaggggcaaatcaacctgcgtgatgcggttaat
ggcacaatttcttacgttaatgagcagggtaaacagtaccaattgcaaccagacccggct
gttctgatcgcacgggtaagagggattcatttaccggaaaaacatgttctctatcagaat
gagccaatcgccggtggattgtttgattttgcgctctatttttaccacaaccataaacaa
ttgctggcaaaggggagcggcccctatttctacttaccaaaaattcagtcttatcacgaa
gctcagtggtggagtgatgtattcagctttgcagaagatcgttttgatctgccgagaggc
acaatcaaagcaacggtattgattgaaactctgcctgctgtatttcagatggatgagatt
ctttaccatcttcggcaccatatcgttggccttaattgtggccgctgggattatattttc
agctacattaaaacactgaaaaatcatagtgatcgggttctgcctgatcgtcagtctgtc
acgatggatcaacctttcctcaatgcttattcccgtttgctgatcaaaacctgccataag
cgcggagcatttgcgatggggggaatggcagcttttatccccagcaaagatattgagcgc
aacaattgggtactagataaagtccgggcggataaagagctggaagcacgcaatggtcat
gatggtacatggattgcccacccaggtcttgccgacacggtaatggacgttttcgatagg
gtcttggcagagcggcaaaaccagttagatattttccgtgaagaagatgcaccgattacc
gcagctcaattactggaaccttgcccaggcgatcgtactgaagaaggtatgcgggccaat
attcgtgtagcggttcaatacattgaagcgtggatttcaggaaatgggtgcgttcctatt
tatggtttgatggaagatgctgcgacagccgaaatttcccggacatctatttggcaatgg
attcatcacgaaaaatcattatctaacggtaaaaaagtgacaaaaagtttgttcaagcag
atgttggcagaggaaatggaggttattaagcaggaagtgggagaaacacgtttcagtcaa
gggcgatttagcgatgcggccaagttgatggagcgcattacaactcaggacgagctgata
gatttcctgacgttgccgggatatcaattgcttgattag

DBGET integrated database retrieval system