KEGG   Photorhabdus luminescens: plu4768Help
Entry
plu4768           CDS       T00149                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
plu  Photorhabdus luminescens
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    plu4768 (glpK)
Enzymes [BR:plu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     plu4768 (glpK)
Exosome [BR:plu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   plu4768 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
5549647..5551170
Genome map
AA seq 507 aa AA seqDB search
MTTENMIEKKYIVALDQGTTSSRAIILDHDANIISISQREFTQIYPKPGWVEHDPMEIWA
TQSSTLVEVLAKADISSDQIAGIGITNQRETTIIWEKETGKPIYNAIVWQCRRTADACTK
LKQKEGLEEYIRQNTGLVVDPYFSGTKVKWILDNVAGARERAEKGELLFGTVDTWLVWKM
TQGRVHVTDFTNASRTMLFNIHNLEWDQHILDELQIPRSLLPSVHSSSEIYGQTNIGGKG
GTRIPISGIAGDQQAALYGQLCVQPGMAKNTYGTGCFLLMNTGTDAVRSNHGLLTTIACG
PRGEVNYALEGAVFVGGASIQWLRDELKLIADAADSEYFATKVKNSNGVYVVPAFTGLGA
PYWDPYARGSIFGLTRGTNSNHIIRATLESIAYQTRDVLDAMQADAGTRLQALRVDGGAV
ANNFLMQFQSDILGTRVERPVVRESTALGAAFLAGLAVGYWKDLDEVKSKATIEKEFRPG
IETTERNYKYNGWKKAVARAQDWEDKG
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagaaaatatgattgagaaaaagtatattgtcgcccttgatcagggaaccacc
agttcccgagcaataattcttgatcacgacgccaatattatctcaatttcccaaagagag
tttacgcaaatttatcctaaaccgggttgggtagaacacgatccaatggaaatctgggca
acccaaagctcaacgctggtagaagtattggcgaaagcggatattagttctgatcagatt
gccggtattggtattaccaaccaacgtgaaacaacgattatttgggaaaaagagaccggt
aaacctatctacaatgccatcgtttggcaatgtcgccgtaccgcggacgcgtgtactaaa
ctaaaacaaaaagagggattggaagaatatattcgccagaatacagggctggtagtagac
ccttatttctccggcaccaaagtaaaatggatcttagataacgtcgcaggtgcccgtgaa
cgggctgaaaaaggtgagctcctattcggtactgtggatacttggctggtatggaaaatg
actcaaggccgagtccacgttaccgatttcacaaacgcctcccgaacgatgctgttcaat
attcacaatctggagtgggatcagcatattcttgatgaattacaaatccctcgttcccta
ctgcctagcgttcattcatcttctgagatttatggtcagaccaacatcggcggtaaaggc
ggcactcggatccctatctcaggtatcgcaggtgatcaacaagctgctctatatggtcaa
ctttgtgtccaaccgggtatggcgaaaaacacctacgggacaggctgtttcctgctgatg
aacacgggtacagatgccgtacgctccaatcacggcctactgacaaccattgcctgtggt
cctcgcggcgaagtgaactatgcgcttgaaggtgcggttttcgttggtggtgcctctatt
cagtggttgcgtgatgaactgaaacttattgcagatgcggctgactccgaatattttgcc
actaaagttaaaaatagtaacggcgtgtatgtggtccctgcttttaccggccttggtgcc
ccctattgggacccctacgcccgagggtcaattttcggcctaacccgcggtaccaacagt
aatcacatcattcgtgcgacgctggaatctatcgcctatcagacccgtgatgtactggat
gctatgcaagctgatgcaggcacccggctgcaagcactacgggtagatggcggagccgtt
gccaataacttcctgatgcaattccaatcagatattcttggcacccgggtagaacgccct
gtggtgcgtgaaagcacagcattgggcgcagcattcctcgcaggattggcagttggctac
tggaaagacctggatgaagtgaaaagtaaagccaccattgagaaagaattccgtccgggt
attgaaaccaccgagcgtaattacaaatacaatggctggaaaaaagcagttgcccgtgcg
caggattgggaagataaaggctaa

DBGET integrated database retrieval system