KEGG   Photorhabdus luminescens: plu4774Help
Entry
plu4774           CDS       T00149                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase isozyme I (phosphofructokinase-1) (phosphohexokinase-1)
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
plu  Photorhabdus luminescens
Pathway
plu00010  Glycolysis / Gluconeogenesis
plu00030  Pentose phosphate pathway
plu00051  Fructose and mannose metabolism
plu00052  Galactose metabolism
plu00680  Methane metabolism
plu01100  Metabolic pathways
plu01110  Biosynthesis of secondary metabolites
plu01120  Microbial metabolism in diverse environments
plu01130  Biosynthesis of antibiotics
plu01200  Carbon metabolism
plu01230  Biosynthesis of amino acids
plu03018  RNA degradation
Module
plu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    plu4774 (pfkA)
   00030 Pentose phosphate pathway
    plu4774 (pfkA)
   00051 Fructose and mannose metabolism
    plu4774 (pfkA)
   00052 Galactose metabolism
    plu4774 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    plu4774 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    plu4774 (pfkA)
Enzymes [BR:plu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     plu4774 (pfkA)
Protein phosphatases and associated proteins [BR:plu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     plu4774 (pfkA)
Messenger RNA biogenesis [BR:plu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     plu4774 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: CAE17146
Pasteur: plu4774
UniProt: Q7MYB1
Position
complement(5555554..5556525)
Genome map
AA seq 323 aa AA seqDB search
MSNEIKRIGVLTSGGDAPGMNAAIRGVVRAGLTEGLEVFGIYDGYLGLYENRMKKLDRFS
VSDMINRGGTFLGSARFPEFRDEKVRTVAIENMRKNGLDALVVIGGDGSYLGAKKLTEAG
FPCIGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSTSHKRISIVEVMGRYCGDL
TLSAAIAGGCEFIVLPEVSFSCDELVAEIKAGIDKGKRHAIVAITEHVCDVYELAKHIEK
ETHHETRATVLGHVQRGGSPVAYDRILASRMGAYSIQLLLEGYGGRCVGIQNEKLVHHDI
IDAVQNMKRVFKQDWLETAKKLY
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgagatcaaaagaatcggtgtcttaacgagtggcggtgatgcgccgggtatg
aatgcagctattcgtggtgtggttcgtgcgggattaaccgaagggttggaagttttcggt
atttatgatggctatcttggcttgtatgaaaaccgtatgaagaaacttgaccgttttagt
gtatccgacatgattaaccgtggtggtacttttctaggttcagcccgtttccctgagttc
agggatgagaaggttcgtactgtcgctattgagaacatgagaaaaaatggtcttgatgct
ctggtcgttatcggcggtgacggttcctatcttggcgcgaaaaaactgacagaagcgggt
ttcccctgcattggcctgccgggcactattgataatgatgtggcgggtaccgactatacc
atcggctatttcactgcgctggaaactgtggttgaagcgattgaccgtctgcgtgatacc
tcgacttcccacaaacgtatttccattgttgaagtaatgggacgttattgtggtgatctc
actttgtcagccgctattgcaggcggttgtgagtttattgttttaccggaagtctcattt
agttgtgatgagctcgtagctgaaattaaagcgggtatcgataaaggcaaacgccacgcc
atcgttgcaattaccgaacatgtttgtgatgtttatgaacttgcgaaacatatcgaaaaa
gagacgcatcatgaaacccgtgccacagtcttaggccatgttcagcgtggtggttcccca
gttgcctatgatcgtattctggcttcccgtatgggggcatattccattcaattactgttg
gaaggttatggtggtcgttgtgttggtattcagaacgagaaacttgttcatcatgacatc
attgatgcagtgcaaaatatgaaacgtgtgtttaaacaggattggttggaaaccgcgaaa
aagttgtattga

DBGET integrated database retrieval system