KEGG   Photorhabdus luminescens: plu4774Help
Entry
plu4774           CDS       T00149                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
plu  Photorhabdus luminescens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    plu4774 (pfkA)
   01230 Biosynthesis of amino acids
    plu4774 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    plu4774 (pfkA)
   00030 Pentose phosphate pathway
    plu4774 (pfkA)
   00051 Fructose and mannose metabolism
    plu4774 (pfkA)
   00052 Galactose metabolism
    plu4774 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    plu4774 (pfkA)
Enzymes [BR:plu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     plu4774 (pfkA)
Protein phosphatases and associated proteins [BR:plu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     plu4774 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(5555554..5556525)
Genome map
AA seq 323 aa AA seqDB search
MSNEIKRIGVLTSGGDAPGMNAAIRGVVRAGLTEGLEVFGIYDGYLGLYENRMKKLDRFS
VSDMINRGGTFLGSARFPEFRDEKVRTVAIENMRKNGLDALVVIGGDGSYLGAKKLTEAG
FPCIGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSTSHKRISIVEVMGRYCGDL
TLSAAIAGGCEFIVLPEVSFSCDELVAEIKAGIDKGKRHAIVAITEHVCDVYELAKHIEK
ETHHETRATVLGHVQRGGSPVAYDRILASRMGAYSIQLLLEGYGGRCVGIQNEKLVHHDI
IDAVQNMKRVFKQDWLETAKKLY
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgagatcaaaagaatcggtgtcttaacgagtggcggtgatgcgccgggtatg
aatgcagctattcgtggtgtggttcgtgcgggattaaccgaagggttggaagttttcggt
atttatgatggctatcttggcttgtatgaaaaccgtatgaagaaacttgaccgttttagt
gtatccgacatgattaaccgtggtggtacttttctaggttcagcccgtttccctgagttc
agggatgagaaggttcgtactgtcgctattgagaacatgagaaaaaatggtcttgatgct
ctggtcgttatcggcggtgacggttcctatcttggcgcgaaaaaactgacagaagcgggt
ttcccctgcattggcctgccgggcactattgataatgatgtggcgggtaccgactatacc
atcggctatttcactgcgctggaaactgtggttgaagcgattgaccgtctgcgtgatacc
tcgacttcccacaaacgtatttccattgttgaagtaatgggacgttattgtggtgatctc
actttgtcagccgctattgcaggcggttgtgagtttattgttttaccggaagtctcattt
agttgtgatgagctcgtagctgaaattaaagcgggtatcgataaaggcaaacgccacgcc
atcgttgcaattaccgaacatgtttgtgatgtttatgaacttgcgaaacatatcgaaaaa
gagacgcatcatgaaacccgtgccacagtcttaggccatgttcagcgtggtggttcccca
gttgcctatgatcgtattctggcttcccgtatgggggcatattccattcaattactgttg
gaaggttatggtggtcgttgtgttggtattcagaacgagaaacttgttcatcatgacatc
attgatgcagtgcaaaatatgaaacgtgtgtttaaacaggattggttggaaaccgcgaaa
aagttgtattga

DBGET integrated database retrieval system