KEGG   Candidatus Portiera aleyrodidarum BT-B-HRs: C530_113Help
Entry
C530_113          CDS       T02267                                 

Definition
Dihydrolipoamide succinyltransferase component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ply  Candidatus Portiera aleyrodidarum BT-B-HRs
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ply00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    C530_113
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C530_113
  Amino acid metabolism
   00310 Lysine degradation
    C530_113
Enzymes [BR:ply01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     C530_113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
132207..133283
Genome map
AA seq 358 aa AA seqDB search
MLEVVSPTEGFLQIIKIPVGKKCKSEQLLGIIVAQKEEGFYSSGSSSTSTNIKQQKLCKK
EQKVDESEKQELKQFYKQAIELEESYSPEVRKAKTSIDVENLFENGTVQDKRVNIRKENV
KYSINEIGVKRVQLSRLRQTITKRIVKAQKNAAMLTTYNEVDMGNILEIRTKYRELFEKK
HGTKLGLMGFFVKACTVALKQFKKVNAVIDDKEIVYHNYQDIGIAVSTNRGLVVPILRHT
DSIKIEEIEKKIMDFRKRGVDGKLSIKELTGGTFTISNGGVFGSLFSTPIINPPQTAILG
MHKIQNRPVVLKGEIVIRPMMYLALSYDHRLIDGKDAVNFLFFVKELLEQPIRFILNI
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
ttgcttgaggttgtttcaccaactgaagggtttcttcaaattataaagataccagtaggt
aaaaaatgcaaatccgagcaattgttaggtattattgtagcacaaaaagaagaaggtttt
tatagttcaggttcatcaagcacaagcacaaacatcaaacagcaaaaattgtgtaaaaaa
gagcaaaaggtagatgaatcagaaaaacaagaattaaaacagttttataaacaagcaata
gaattagaagaaagttattcaccagaggtacgtaaggctaagactagtatagatgttgaa
aacttatttgagaatggcacagtacaagataaaagggtaaatattagaaaagaaaatgtt
aaatatagtattaatgaaattggagttaaaagagtacaattaagtcgtttacgtcagacg
attactaaacgtatcgtgaaagctcaaaaaaatgctgcaatgttaactacttataatgaa
gtagatatgggtaatatattagaaatacgcacaaaatatcgagaactatttgaaaagaaa
catggaactaagctagggttaatgggattttttgtaaaagcttgtacggtggcgctaaaa
cagttcaaaaaagtaaatgcagttattgatgataaagaaattgtttatcataattatcaa
gacataggaatagcagtttctacaaataggggtttagttgttcctattttaaggcatact
gattctataaaaatagaagaaatagaaaaaaaaattatggattttaggaaacgtggtgtt
gatggaaaattaagtattaaagaattaactggtggaacttttacgataagtaatggagga
gtttttggatctctgttttctactcctattattaatccccctcaaactgctattttggga
atgcataaaattcaaaaccgtcctgtagttttaaaaggagaaatagttatacggcctatg
atgtatttagccttgtcgtatgatcatcgtcttattgatggaaaagatgcagttaatttt
ttattttttgttaaggagcttttagaacaacccattcgttttatattaaacatttaa

DBGET integrated database retrieval system