KEGG   Candidatus Portiera aleyrodidarum BT-B-HRs: C530_139Help
Entry
C530_139          CDS       T02267                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ply  Candidatus Portiera aleyrodidarum BT-B-HRs
Pathway
ply00010  Glycolysis / Gluconeogenesis
ply00020  Citrate cycle (TCA cycle)
ply00620  Pyruvate metabolism
ply01100  Metabolic pathways
ply01110  Biosynthesis of secondary metabolites
ply01120  Microbial metabolism in diverse environments
ply01130  Biosynthesis of antibiotics
ply01200  Carbon metabolism
Module
ply_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ply00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C530_139
   00020 Citrate cycle (TCA cycle)
    C530_139
   00620 Pyruvate metabolism
    C530_139
Enzymes [BR:ply01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     C530_139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF1725
Motif
Other DBs
NCBI-ProteinID: AFT80783
Position
complement(158741..159853)
Genome map
AA seq 370 aa AA seqDB search
MIIKLPEIGDINKKVEVIEIPVKVGEFIKKDDTIVVLESEKATIDLPSPNEGTITKILIK
EGENIYSGKSIMELEDIINKKVILNKEKSIAQAGPAAKLMARKLGIDLETDKIIGSGKKN
CILKEDLKSYIKDKRIESSEDNTDQNVKNILSVSAKKLHNSWRNIPHVTHFDELDITKVE
KFRKTIKYELGIKITLLSFFIKVCSCALQKFSKFNMLLDLKTNKRNFHKSSHNNISIAIN
TSKGLLVPVIKHVDKKNIIDIALELKEITKRTLIGKNKLDDMMGGCFTISNLGIIGGKGF
TPIINSPEIGILGIGKTNIKPIWTGKQFKPTTMLPICLSYDHRFINGVYAAKFIKFIIKL
LTDIRNWIVC
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtgataataaagctacctgaaataggtgatataaataaaaaagttgaagttatagaaata
cccgtaaaagtaggagaatttataaaaaaagatgacactatagttgttttagagtcagaa
aaagctactattgatttaccttcaccaaacgaaggaacaataactaaaattttaattaaa
gaaggtgaaaacatatattcgggtaagtcaataatggaattagaagacattataaacaaa
aaagttattttaaataaagaaaaaagtattgcacaggcgggtcctgctgcaaaattaatg
gcaagaaaattaggtattgatttagaaacagacaaaataatcggaagtggaaagaaaaat
tgtattttaaaagaagatttaaaaagttatataaaagataagagaatagagagttcagaa
gacaacactgatcaaaacgtaaagaatatattaagtgtaagtgctaaaaagttacataat
agttggagaaatatacctcatgtaactcattttgatgaattagatataacaaaagtagaa
aagtttagaaaaacaataaaatatgaattaggtattaaaataacattattatcttttttt
ataaaagtatgttcttgtgcattacaaaaattttctaagtttaatatgttgttggattta
aaaacaaataaacgtaattttcacaaatcaagccataataacattagcattgctataaat
acatcaaaaggtttgttagtgcccgtaataaaacatgttgataaaaaaaatatcattgat
attgctttagaattaaaagaaataactaaaagaacattaataggtaaaaataaactagat
gatatgatgggtggctgttttacaatatctaatttaggaataataggtggtaaaggtttt
actccaatcattaacagtccagaaataggaattttaggcattggcaaaacaaacattaaa
cctatttggactggtaaacaatttaaaccaacaacaatgttaccaatttgtctctcgtat
gatcatagatttataaatggcgtttatgcagcaaagtttattaaatttataattaagtta
ttaactgatattcgtaattggattgtttgttaa

DBGET integrated database retrieval system