KEGG   Candidatus Portiera aleyrodidarum BT-B-HRs: C530_173Help
Entry
C530_173          CDS       T02267                                 

Definition
Succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ply  Candidatus Portiera aleyrodidarum BT-B-HRs
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ply00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    C530_173
  Amino acid metabolism
   00300 Lysine biosynthesis
    C530_173
Enzymes [BR:ply01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     C530_173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
210558..211712
Genome map
AA seq 384 aa AA seqDB search
MYYLLKLVLNLLSKNSITPNDKGCQYLLSNIFKRLCFRVEVFNKKGVHNLWVTNGFCKKT
LLFVGHTDVVPSGPIKAWEINPFLPYLNNRGYIISRGIVDMKGSLCSMIKATCNFIKLYP
KSKEKIAFLITSDEEGDGNYGTKYVINKLIKRNEIINYCIIGEPTSKSNTGDTLKIGRRG
SLNAKIIIYGIQGHIAYTKQLLNPIHILINIIHYLLKIRWDKGNKYFSKTSFQISNFIAG
LGVSNMLPKYAKVLCNFRFSNELTVNKIKTKVSNIFLLFNLNKKKDFKINWYLSGEPYLT
KKGTLLNAVIFGINYMCKIQPKKNTNGGISDGRFVKNLCKQIIELGLINATIHKINECVC
VSDIILLTKLYQLIIEYLFIYKFK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtattatcttttaaaactagtattaaatttactttcaaaaaactctattacacctaat
gacaaaggatgtcaatatttgcttagtaatatatttaaacgtttatgttttcgtgtagaa
gtttttaataaaaaaggagttcataatttatgggttacaaacggattttgtaaaaaaaca
ttgttatttgttggtcatacagatgtagttccttcaggcccaattaaagcatgggaaatt
aacccgtttttaccttatttaaataatagaggatatattatatcacgtggaattgtcgat
atgaaaggtagtttatgttcaatgataaaagcaacatgtaattttataaaattatatcca
aaatctaaagagaaaatagcttttttaataacaagtgatgaagaaggtgatggaaattat
ggtactaaatatgttataaataagttaataaaaagaaatgaaataataaattattgtatt
atcggtgagcctactagtaaatcaaatacaggtgatactcttaaaataggtagacgaggt
tcattaaatgccaaaataataatatacggtattcaaggacatatagcgtatacaaaacaa
ttgctaaatccaatacatatattaattaatataatacattatttattaaaaattagatgg
gataaaggtaataaatatttttctaaaaccagttttcaaatatccaacttcattgcagga
ttaggtgtaagtaatatgttacctaaatacgcaaaagtattatgtaattttagattttca
aatgaacttacagttaataaaattaaaaccaaagtaagtaacatatttttactgtttaat
ttaaacaaaaaaaaagattttaaaatcaattggtatctatctggagaaccatacctaaca
aaaaaaggtactttgttaaatgctgtaatttttggaattaattatatgtgcaaaatacaa
ccaaaaaaaaatacaaatggtggcatatcagatggtagatttgtcaaaaatctttgtaaa
caaataattgagttaggcttaataaatgccactatacataaaataaatgaatgtgtttgc
gtttctgatattatactattaacaaaactgtatcaacttatcattgaatatttgtttatt
tataaatttaaataa

DBGET integrated database retrieval system