KEGG   Candidatus Portiera aleyrodidarum BT-B-HRs: C530_229Help
Entry
C530_229          CDS       T02267                                 

Definition
Tryptophan synthase alpha chain
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ply  Candidatus Portiera aleyrodidarum BT-B-HRs
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ply00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    C530_229
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C530_229
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C530_229
Enzymes [BR:ply01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     C530_229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
285160..285966
Genome map
AA seq 268 aa AA seqDB search
MKLNKRIINCFEQKKRAAFVTFITAGDQDYEKSLTLINSLPKAGADIIELGMPFTDPIAD
GEIIQKSTQRSLKTGQNQKKTLELVKAFRLFNKKTPIILMGYYNPIYRYGIKKFIKDAKN
AQIDGLIIVDLPPEHAQEVSVPANKQGIDFINIITPNTNIKRIPFIVKNSSGYIYYISIN
GVTGGSVPIFYEVEKAVKLIRKYTNLPIAVGFGVKNRNSVKKLANISDAVVVGSALLKQI
EIHCYDQKTAISNVLNLTSRLSRGLVKI
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttaataagcgtataataaattgttttgaacaaaaaaaaagagcggcttttgta
acgtttataacagcaggagatcaagattacgaaaaatctttaacattaataaatagttta
cctaaagcaggagcagatattatcgaattgggtatgccatttacagatcctatcgctgac
ggtgaaattattcagaaatcaactcaaaggtcattaaaaactggtcaaaatcaaaaaaaa
acacttgaattggtaaaagcttttcgtttgtttaataaaaaaacaccaataatattgatg
gggtattacaatccaatttatagatatggaataaaaaagtttattaaagatgctaagaat
gctcaaattgatggattaataattgtggacttaccaccagaacacgctcaagaagttagt
gttccagcaaacaaacagggaattgattttataaatataataactcctaacactaacatt
aaaagaataccttttattgtaaaaaattcatcaggatacatttattatatatcaataaat
ggagttacgggaggaagtgttccaatattttatgaagtagaaaaagcggttaaattaata
cgtaaatacacaaatttgccaattgcagttggatttggtgtaaaaaacagaaactcagta
aaaaaactcgcaaacataagtgatgcggttgtagtaggatctgctttattaaaacaaatc
gaaatacattgttatgaccaaaaaacagcaattagtaatgtattaaacttaacaagtaga
ttatctagaggattagttaaaatttaa

DBGET integrated database retrieval system