KEGG   Candidatus Portiera aleyrodidarum BT-B-HRs: C530_229Help
Entry
C530_229          CDS       T02267                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ply  Candidatus Portiera aleyrodidarum BT-B-HRs
Pathway
ply00260  Glycine, serine and threonine metabolism
ply00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ply01100  Metabolic pathways
ply01110  Biosynthesis of secondary metabolites
ply01130  Biosynthesis of antibiotics
ply01230  Biosynthesis of amino acids
Module
ply_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ply00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C530_229
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C530_229
Enzymes [BR:ply01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     C530_229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA ParA
Motif
Other DBs
NCBI-ProteinID: AFT80871
Position
285160..285966
Genome map
AA seq 268 aa AA seqDB search
MKLNKRIINCFEQKKRAAFVTFITAGDQDYEKSLTLINSLPKAGADIIELGMPFTDPIAD
GEIIQKSTQRSLKTGQNQKKTLELVKAFRLFNKKTPIILMGYYNPIYRYGIKKFIKDAKN
AQIDGLIIVDLPPEHAQEVSVPANKQGIDFINIITPNTNIKRIPFIVKNSSGYIYYISIN
GVTGGSVPIFYEVEKAVKLIRKYTNLPIAVGFGVKNRNSVKKLANISDAVVVGSALLKQI
EIHCYDQKTAISNVLNLTSRLSRGLVKI
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttaataagcgtataataaattgttttgaacaaaaaaaaagagcggcttttgta
acgtttataacagcaggagatcaagattacgaaaaatctttaacattaataaatagttta
cctaaagcaggagcagatattatcgaattgggtatgccatttacagatcctatcgctgac
ggtgaaattattcagaaatcaactcaaaggtcattaaaaactggtcaaaatcaaaaaaaa
acacttgaattggtaaaagcttttcgtttgtttaataaaaaaacaccaataatattgatg
gggtattacaatccaatttatagatatggaataaaaaagtttattaaagatgctaagaat
gctcaaattgatggattaataattgtggacttaccaccagaacacgctcaagaagttagt
gttccagcaaacaaacagggaattgattttataaatataataactcctaacactaacatt
aaaagaataccttttattgtaaaaaattcatcaggatacatttattatatatcaataaat
ggagttacgggaggaagtgttccaatattttatgaagtagaaaaagcggttaaattaata
cgtaaatacacaaatttgccaattgcagttggatttggtgtaaaaaacagaaactcagta
aaaaaactcgcaaacataagtgatgcggttgtagtaggatctgctttattaaaacaaatc
gaaatacattgttatgaccaaaaaacagcaattagtaatgtattaaacttaacaagtaga
ttatctagaggattagttaaaatttaa

DBGET integrated database retrieval system