KEGG   Candidatus Portiera aleyrodidarum BT-B-HRs: C530_247Help
Entry
C530_247          CDS       T02267                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ply  Candidatus Portiera aleyrodidarum BT-B-HRs
Pathway
ply00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ply01100  Metabolic pathways
ply01110  Biosynthesis of secondary metabolites
ply01130  Biosynthesis of antibiotics
ply01230  Biosynthesis of amino acids
Module
ply_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ply00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C530_247
Enzymes [BR:ply01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     C530_247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AFT80885
Position
303624..304442
Genome map
AA seq 272 aa AA seqDB search
MKILFNILKYKRNTINVCINKLSLKILRKGFYSNKEQFSNNKFIKSIKNKQYKNQTSIIA
EIKRCSPSKGIITETKNIEKLALNYFLNGAVCISILTEKNFFKGSKKYILTVKKLFDIPI
LFKDFIIDEYQVFEARLLCTDCILLIVSILKLDLLKKLYNLALSIGLDVLLEIHNLLELE
VALFSLNAKFIGINNRNLYTFNTSINITISLLKYMPSNVVFVTESGILNVNDFIKLQMFG
VNVFLIGEFLLSNNDIFLRTLLDKANKYILTY
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattgtttaatattttaaaatataaacgtaatacaattaatgtttgtataaat
aaattatctttaaaaattttacgtaaagggttttattcaaataaagagcagttttctaat
aacaaatttattaaatccataaaaaacaaacaatataagaatcaaacttcaataattgca
gaaattaaacgatgttcaccttctaaaggaattattactgaaactaagaacattgaaaaa
ctagctttgaattattttttaaatggagctgtgtgtatttcaatattaacagaaaagaat
ttttttaaaggtagtaaaaaatatatattaactgtcaaaaaactttttgatatacctatt
ttgtttaaagattttattattgatgaatatcaagtttttgaagcacggttactatgtaca
gattgtattttgttaatagtttcaattttaaaacttgatttattaaaaaagttatataat
ttggccttatcaattggtttagatgtattacttgaaatacataaccttttagaattagaa
gtagcgttattttctttaaatgcaaaatttataggtatcaataatcgaaatttatataca
tttaatacatctattaacataaccatttcattattaaaatatatgccttcaaatgttgtt
tttgttacagaatctggaattttaaatgttaatgattttataaaattacaaatgtttggt
gttaatgtttttttaataggagagtttttattaagtaataatgatatctttttaagaact
ttacttgataaagctaataaatatatattaacatattaa

DBGET integrated database retrieval system