KEGG   Pseudoalteromonas luteoviolacea: S4054249_13900Help
Entry
S4054249_13900    CDS       T04577                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
plz  Pseudoalteromonas luteoviolacea
Pathway
plz00071  Fatty acid degradation
plz00072  Synthesis and degradation of ketone bodies
plz00280  Valine, leucine and isoleucine degradation
plz00310  Lysine degradation
plz00362  Benzoate degradation
plz00380  Tryptophan metabolism
plz00620  Pyruvate metabolism
plz00630  Glyoxylate and dicarboxylate metabolism
plz00640  Propanoate metabolism
plz00650  Butanoate metabolism
plz00900  Terpenoid backbone biosynthesis
plz01100  Metabolic pathways
plz01110  Biosynthesis of secondary metabolites
plz01120  Microbial metabolism in diverse environments
plz01130  Biosynthesis of antibiotics
plz01200  Carbon metabolism
plz01212  Fatty acid metabolism
plz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:plz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    S4054249_13900
   00630 Glyoxylate and dicarboxylate metabolism
    S4054249_13900
   00640 Propanoate metabolism
    S4054249_13900
   00650 Butanoate metabolism
    S4054249_13900
  Lipid metabolism
   00071 Fatty acid degradation
    S4054249_13900
   00072 Synthesis and degradation of ketone bodies
    S4054249_13900
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    S4054249_13900
   00310 Lysine degradation
    S4054249_13900
   00380 Tryptophan metabolism
    S4054249_13900
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    S4054249_13900
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    S4054249_13900
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    S4054249_13900
Enzymes [BR:plz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     S4054249_13900
Exosome [BR:plz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   S4054249_13900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AOT08883
Position
1:complement(3299298..3300476)
Genome map
AA seq 392 aa AA seqDB search
MSNEAVVIVAAKRTPMGGFMGSLSGAAATDLGATAIKAVMNDTGLSDASIDEVIMGCVLP
AGLGQAPARQAVLHAGLARSTGATTINKVCGSGLKAAMFAHDLIKSGSIKTAIAGGMESM
TNAPYFMPNARGGMRMGHNQVIDHMMADGLEDAYDKKAMGCFAQDTADQYGITRENMDEF
ALNSLSKANAAIESGSFDNEVIPHVISTRKGDIEVTTDEQPGNARPDKIPSLRPAFKKDG
TITAANSSSISDGAAALMLMSESEAQAHGLTPLCKIVAHATHSQAPAEFTIAPVGAMNSL
LDKAGWSKEDVDLWEINEAFAMVTMLAINEMKLDSAKVNVNGGACALGHPIGASGARILV
TLIHALRNRGLSKGVASLCIGGGEAVALAVEV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacgaagccgtagtcatcgtagcagcaaaacgtacccctatgggtggatttatg
ggtagcctatctggtgcagctgcaacagatttaggtgcaactgcaatcaaagctgtcatg
aatgatactggtttatcggatgccagcatcgatgaagttattatgggttgtgtattacca
gcaggtcttggccaagcaccagcgcgtcaagcagtactacacgcaggtcttgcacgctca
acaggtgcaacaactattaataaagtatgtggctcaggtttaaaagcagccatgttcgcc
catgatttaattaaatcaggcagtatcaaaactgcgattgcaggtgggatggaaagcatg
acaaatgcgccttatttcatgccaaatgcacgtggtggtatgcgtatgggtcacaaccaa
gttatcgaccatatgatggctgatggtcttgaagatgcttacgataaaaaagcaatgggc
tgttttgctcaagatacagccgatcaatatggcattactcgcgaaaatatggacgagttt
gcacttaactctttaagtaaagcaaacgcagcgattgaaagcggcagtttcgataatgaa
gtgatcccgcatgttatttctactcgtaaaggcgacattgaagtaacaactgacgaacag
ccaggtaacgcacgtccagataagattccatcgctacgtccagcgtttaaaaaagacggc
accatcacagcagctaactcgtcatctatttcagatggtgcagcagcgcttatgttgatg
agtgagtcagaagcgcaagcacatggtctgacacctttatgtaagattgtggcgcacgca
acacattctcaagcacctgctgagtttacaattgcgcctgtaggtgcaatgaactcattg
cttgataaagcaggttggtcaaaagaagacgtggacctttgggaaatcaatgaagcattt
gccatggtaacgatgcttgctatcaatgaaatgaaacttgatagtgcaaaagttaacgtc
aatggtggtgcatgtgcacttggtcacccaattggtgcaagtggtgcacgtattttggtg
actttgattcacgcacttcgcaatcgtggcctgtcaaaaggcgttgcatcactgtgtatt
ggtggtggtgaggcggttgcactagcagtagaagtttaa

DBGET integrated database retrieval system