KEGG   Prochlorococcus marinus SS120: Pro_0551Help
Entry
Pro_0551          CDS       T00137                                 

Gene name
rbcL
Definition
Ribulose 1,5-bisphosphate carboxylase large subunit (EC:4.1.1.39)
Orthology
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pma  Prochlorococcus marinus SS120
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Class
Metabolism; Overview; Carbon metabolism [PATH:pma01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:pma00630]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:pma00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
524454..525866
Genome map
AA seq 470 aa AA seqDB search
MSKKYDAGVKEYRDTYWTPDYVPLDTDLLACFKCTGQEGVPREEVAAAVAAESSTGTWST
VWSELLTDLEFYKGRCYRIEDVPGDKESFYAFIAYPLDLFEEGSITNVLTSLVGNVFGFK
ALRHLRLEDIRFPMAFIKTCGGPPQGIVVERDRLNKYGRPLLGCTIKPKLGLSGKNYGRV
VYECLRGGLDLTKDDENINSQPFQRWRDRFEFVAEAVKLAQQETGEVKGHYLNCTATTPE
EMYERAEFAKELDMPIIMHDYITGGFTANTGLANWCRKNGMLLHIHRAMHAVIDRHPKHG
IHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQTTLGYIDNLRESFVPEDRTRGNFFDQDW
GSMPGVFAVASGGIHVWHMPALLAIFGDDSCLQFGGGTHGHPWGSAAGAAANRVALEACV
KARNAGREIEKESRDILMEAAKHSPELAIALETWKEIKFEFDTVDKLDVQ
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaagtatgacgctggggttaaggagtacagagacacctactggactcccgat
tatgtacccctagacacagaccttttggcttgttttaaatgcacaggtcaagaaggagtt
ccaagagaggaagttgctgctgctgtagctgctgaatcatcaacaggtacttggtctacg
gtttggtctgaattgctaactgaccttgaattttacaagggccgttgttatcgcattgag
gacgtacccggagataaagaatctttttatgcattcattgcatatcctctagatcttttt
gaagaaggctcaataacaaacgttctgacttcattggtcggtaatgtctttggatttaaa
gctttacgccatttgcgtttagaagatatccgcttcccaatggccttcatcaagacatgt
ggaggaccccctcaaggaatcgttgttgagcgtgaccgcttgaataagtatggtcgccct
cttcttggttgcaccattaagcctaagcttggcctttctggtaaaaactatggacgtgtg
gtttatgaatgccttcgaggtggcttagatcttacaaaagatgatgagaacataaactca
cagcccttccagcggtggagagatcgttttgagtttgttgctgaagctgtaaagcttgcc
cagcaagagacaggcgaggttaaaggtcattatcttaattgcacagctactactcctgaa
gagatgtatgagcgtgcagagttcgctaaagagcttgatatgcctattatcatgcatgac
tacataactggaggctttactgctaacacaggcttggccaactggtgccgtaagaatggc
atgttgcttcatatccatagagcaatgcatgcggtgattgatcgtcatccaaagcatggt
atccatttccgtgttctagcaaagtgcttacgcctatctggtggagatcaacttcatacc
ggaacggtcgtaggtaagttagaaggtgatcgtcaaaccactcttggttatatcgacaat
ttacgtgaatcctttgtcccagaagaccgcacacgcggtaacttctttgatcaggattgg
ggctctatgccaggcgtatttgccgtcgcttcaggtggtattcatgtatggcatatgcct
gctttgcttgcaatctttggtgacgattcatgccttcagtttggaggtggtactcatggt
catccatggggatcagctgcaggtgcagccgctaaccgtgtagctttagaggcttgtgtt
aaggcacgtaatgcaggtagagagatcgagaaggaaagtcgcgacatccttatggaagct
gcgaagcatagtccagagttggctattgcacttgaaacctggaaggaaattaaattcgag
tttgacaccgttgataaactcgacgttcagtaa

DBGET integrated database retrieval system