KEGG   Prochlorococcus marinus SS120: Pro_0552Help
Entry
Pro_0552          CDS       T00137                                 

Gene name
rbcS
Definition
Ribulose bisphosphate carboxylase small subunit (EC:4.1.1.39)
Orthology
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
pma  Prochlorococcus marinus SS120
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pro_0552 (rbcS)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Pro_0552 (rbcS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Pro_0552 (rbcS)
Enzymes [BR:pma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Pro_0552 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
525970..526311
Genome map
AA seq 113 aa AA seqDB search
MPFQSTVGDYQTVATLETFGFLPPMSQDEIYDQIAYIIAQGWSPVIEHVHPSGSMQTYWS
YWKLPFFGEKDLNVVVNELEACHRAYPDHHVRMVGYDAYTQSQGTAFVVFEGR
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgccttttcagagcacagttggtgactatcaaacagtcgccaccctggagacatttggc
tttttgcctcctatgtcacaggacgaaatttacgaccaaatcgcttacatcatcgcgcag
ggttggagccctgttattgaacatgttcatccaagtggctccatgcagacctattggtct
tattggaaattgcctttctttggtgagaaagatttgaatgtcgttgttaatgagcttgaa
gcttgccaccgcgcatatccagatcaccatgttcgaatggttggttacgatgcttatacc
caaagtcagggtacagctttcgtagtctttgaaggtcgctaa

DBGET integrated database retrieval system