KEGG   Prochlorococcus marinus SS120: Pro_1078Help
Entry
Pro_1078          CDS       T00137                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pma  Prochlorococcus marinus SS120
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pma00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
999042..1001309
Genome map
AA seq 755 aa AA seqDB search
MSTSINIDWLANEGQKLAECRHDNPLGVLGPQQIENKWALRVWMPEADAVNLLLKDGKKK
LTNPNHPWIFETSLEENPGSSYQISVERAGISHTQNDPWAFRHEWMGEIDRHLFAEGNHH
HIWRRMGAHQTKLDLVEGVMFCLWAPNARSVSVIGDMNSWDGRHHPMQKRLGGIWELFIP
HIKKGDLYKYEIRSQEGHCYEKADPYGFQHEVRPAQSSIVSTLDSYKWKDQKWMTQRDKT
DQLNKPISVYEMHLGSWMHSSNKTPYIEKDGSTREPVPAADLKPETRFLTYPELTEKLIP
YVKARGFTHIELMPISEHPFDGSWGYQVTGWYAPTSRYGTPDEFRAFVDTCHSEGIGVIL
DWVPGHFPKDEHGLAFFDGKHLYEHADPRIGEHKEWGTLIFNYSRNEVRNFLVANLVYWF
EQFHIDGIRVDAVASMLYKDYLRPEGEWIPNEDGGNENFEAVNFLQQANHVLFQHFPGAL
SIAEESTTWSGVTKPTDMGGLGFNLKWNMGWMHDMLDYFEIDPWFRQFHQNNVTFSICYN
YTENFMLSLSHDEVVHGKSHLLHKMPGDDWKKYANTRALLAYMWTHPGKKTLFMGMEFGQ
RQEWNVWDDLQWELLEHDPHKGIQLLIDDLNCLYKSQPALWKDDFNEYGFQWIDCKDNTN
SVISFMRRESSTGEWLVVVANFTPETHANYKVGVPVSGYYAEIFNTDAKKYGGSNTGNLG
GKYSTEWNIHEYENALELSLPPLSVLILKYRKNKK
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccagcattaatattgactggctggcaaatgaagggcaaaagcttgcagaatgt
agacatgacaatcctttaggggtactaggtccacaacaaattgaaaataaatgggcatta
agagtgtggatgccagaagctgatgcagtcaatcttcttttaaaagatggaaaaaagaaa
ttaacaaatccaaatcatccctggatttttgaaacatcactagaagaaaatccagggtct
agttaccagataagtgttgaaagggctggcatatcacatacccagaatgatccttgggca
tttcgacacgaatggatgggggaaatagatagacacctttttgcagaaggaaatcatcac
catatatggcgacgcatgggtgctcatcaaacaaagcttgatttagttgaaggagtaatg
ttctgcctctgggctcctaatgccagaagtgtttcagtaattggggacatgaattcatgg
gatggaagacatcatcccatgcaaaaacgacttggtggaatttgggaactttttattcca
catataaaaaaaggagacctttacaaatacgaaattagatctcaagaaggtcattgttat
gagaaagcagacccttatggatttcaacatgaagtgaggccagcccaaagttctatagtt
tcgactcttgattcatataaatggaaagatcaaaaatggatgactcagagagataaaacc
gatcaactgaataaacctatttctgtatatgaaatgcatttaggaagctggatgcattcc
tctaacaaaaccccttatatagaaaaagatggatctactagagaacctgtccctgctgca
gacttaaaaccagaaacaaggttccttacatatcctgaattaactgaaaaacttattcct
tacgtaaaagctagaggctttactcatattgaattaatgcctatatctgaacatcctttc
gatggatcatggggatatcaagttacaggatggtatgcccctacaagcagatacggtacc
ccagatgaatttcgagcttttgttgatacctgtcattcagaaggaataggcgtaattctt
gattgggtgccagggcatttccctaaggatgaacacggtcttgctttttttgatgggaag
cacctatatgagcatgcagatcctcgaataggtgaacacaaagaatggggtaccttgatc
ttcaattacagcagaaatgaagttcgcaattttctagtagctaatctcgtttattggttc
gagcaatttcatatagatggcattagagttgatgctgttgcttcgatgctttataaagat
tatttgcgcccagaaggtgaatggataccaaacgaagacggtggtaatgaaaattttgaa
gcggttaattttcttcaacaagccaatcatgtgctatttcaacattttccaggggcactt
tccatagcggaggaatcaactacatggtcaggagtcacaaaaccaactgatatgggagga
cttggcttcaatctaaaatggaatatgggctggatgcacgatatgctcgattattttgaa
atagatccttggtttagacaatttcatcagaacaatgtaactttttctatttgttataac
tacacagaaaacttcatgctttctcttagtcatgacgaggtagtccatggcaagagtcat
cttcttcataagatgccaggtgacgactggaaaaaatacgctaacactagggctttactt
gcatatatgtggacacatcctggtaaaaaaacattatttatggggatggagtttggacag
aggcaagaatggaatgtttgggatgatctccaatgggaactgttagaacatgatcctcac
aagggtattcaattacttattgacgacctcaattgcctatataagtcacagcccgcatta
tggaaagatgattttaatgagtatggatttcaatggattgattgtaaagacaatacaaac
tctgtaattagttttatgaggagagaaagctcaacaggtgaatggcttgttgttgtagca
aactttactccagagacacatgcaaattataaagtcggtgttccagtatctggatattac
gcagaaatattcaacacagatgctaagaaatatggggggtcaaatactggtaatttaggt
gggaagtattcgacagaatggaatattcatgaatatgaaaatgcgcttgaactttctctt
cctcctctaagtgtccttattctaaaatatcgcaaaaacaaaaaataa

DBGET integrated database retrieval system