KEGG   Prochlorococcus marinus SS120: Pro_1157Help
Entry
Pro_1157          CDS       T00137                                 

Gene name
rbsK
Definition
Sugar kinase, ribokinase family
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pma  Prochlorococcus marinus SS120
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pma00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Pro_1157 (rbsK)
Enzymes [BR:pma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Pro_1157 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1086518..1087342
Genome map
AA seq 274 aa AA seqDB search
MSGNKELKLAVVGHIEWVSFLSVDKMPRQGLINRSNNFKEEPAGGGAVAAVQMSKLTDVP
VHFFTSLGNDYIGEKSFERLSSFGITMHTAWRNKPTRRALSFIDNNGDRAITVIGERLQP
QGMDDLPWSILKEFDGVFITAADSKAIQFCREAKILCATPRVKFKHLNDANIQLDALVGS
NLDPDEKVHKNSLLIKPKVTVLTEGESGGIVNPGGRYKAVELRSKAIDSYGCGDSFAAGL
TYGMAANMDIQKAINLGAKCGAACATQFGPYNSR
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaaacaaagagctcaagcttgctgtagtaggtcatatcgaatgggtgtccttc
ctttccgttgacaaaatgcctagacagggcttgataaatagaagtaataattttaaagag
gagcctgctgggggcggagcagtcgcagcagtacaaatgtcaaaactaactgatgtgcct
gttcacttcttcacttctcttggtaatgattatataggtgaaaaaagttttgagcggctt
tcttcatttggcatcactatgcatacagcttggcgaaataaacccactagaagagctcta
agttttatcgacaacaatggggatagagcgattacagtcataggtgaaaggctgcagcct
caaggaatggatgatttaccctggtccatattaaaagaatttgatggagtttttattact
gctgctgacagtaaagctattcaattttgcagagaagcaaagattctttgcgctactccc
cgagtaaagtttaaacatttaaacgatgcaaatatacaattagacgccttagtgggaagc
aaccttgaccctgacgaaaaagtccacaaaaacagcttattaatcaaaccaaaggtcact
gtcctaacagaaggtgaatcaggaggaatagtcaatcctggtggaagatataaagctgtt
gaacttaggagtaaagcaatagacagttatggatgcggagatagttttgctgctggccta
acatatggaatggcagcaaacatggatattcaaaaagcaattaacttaggcgcaaaatgc
ggtgctgcatgcgcaactcaatttggtccttataatagtagatag

DBGET integrated database retrieval system