KEGG   Prochlorococcus marinus SS120: Pro_1833Help
Entry
Pro_1833          CDS       T00137                                 

Gene name
OLE1
Definition
Fatty-acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pma  Prochlorococcus marinus SS120
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:pma01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pma01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1690865..1691797
Genome map
AA seq 310 aa AA seqDB search
MVSSVIEATAPLRRPVSADKALAASEKLQVKTKKELRYPRKFKRRWGTVGFMGAIHALTI
FALLPRFWSLQNIAALLILYWVTACLGVTLGYHRLLSHRAFKVPHWLERFFATCGALSCQ
HGPIDWVGLHRHHHTFSDTDADHHNSKKGFWWSHMGWMFEPIPALQTVPNFSGDLIQDPY
YRFLNKNFLLLQIPLGALLYWIGHGSESGGWSMVLWGIPFRLVVVYHVTWLVNSATHCWG
NVAFDSGDGSKNNWWVAALTFGEGWHNNHHAYPSSARQGLFKGQIDLTWQHIRLLHALGL
AKKIRLPMKP
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtggtgtccagcgtgattgaagcaacggctccgttaagaaggccagtatccgcagataaa
gcactggctgcatcagagaagcttcaagtaaaaactaaaaaagaattgaggtatccacgc
aaatttaaacggcgctggggaactgtaggtttcatgggagctatccatgccttaacaatt
tttgctctacttccaaggttctggagtcttcagaatatagctgcattattaattctttat
tgggttacagcctgtttaggagtcacgttgggttatcacagactgctttcgcatagagct
ttcaaagttcctcactggctagagaggttttttgcaacctgcggggctttaagttgccaa
catggacctattgactgggtaggacttcacagacatcatcacacattttcagatacagat
gctgatcaccacaacagtaaaaaaggattttggtggagtcatatgggatggatgtttgaa
ccaattccagcactgcaaacagttcctaatttcagtggagatcttattcaagacccctat
tacagatttttaaacaaaaactttttgctacttcaaattccattaggagcattgctttac
tggattggccatggctctgaatcaggaggctggtccatggttctatggggcattccattc
cgtttggttgtcgtttatcacgtgacatggcttgttaattcagctactcattgctggggc
aatgttgcatttgatagtggagatggatctaaaaacaattggtgggtagcagctcttacc
ttcggagaaggctggcataacaatcaccatgcttatccaagctcagctcgtcaaggatta
tttaaaggtcaaattgatctaacttggcaacatattcgtttactccatgctttaggcctt
gctaaaaagatacgattacccatgaagccttaa

DBGET integrated database retrieval system