KEGG   Parus major (Great Tit): 107202035Help
Entry
107202035         CDS       T04864                                 

Gene name
ABHD12
Definition
(RefSeq) monoacylglycerol lipase ABHD12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
pmaj  Parus major (Great Tit)
Brite
Enzymes [BR:pmaj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107202035 (ABHD12)
Peptidases [BR:pmaj01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   107202035 (ABHD12)
Exosome [BR:pmaj04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   107202035 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
3
AA seq 383 aa AA seqDB search
MRKRNESVTVEHERAAAVPGPLDKGCSLRRSLRLPASAAAEGMKRPLGRRYGLWFRLRKL
ILWLLGMYIAIPFLVKLCPAIQAKLVFLNFVRVPYFIDLKRPQDQGLNHTCNYYLQPEED
VTIGVWHTVPAALWKNARGKDQLWFEEALGSSHPVILYLHGNAGTRGGDHRVELYKVLSS
LGYHVVTFDYRGWGDSIGSPSERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNL
VRRLCERETPPDALILESPFTNIREEARSHPFSVIYRYFPGFDWFFLDPITTSGIKFAND
ENVKYISCSLLILHAEDDPVVPFHLGKKLYNIAATSRSFRDYKVQFVPFHTDLGYRHKYI
YRSPELPRILREFLGKSEHEHHH
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaacgcaacgagtcggtcacggtggagcatgagcgcgccgccgccgtgcccggg
cccctcgacaagggctgcagcctgaggcgaagcctgcgcctgcctgcctccgccgccgcc
gagggcatgaagcgaccgctgggcaggcgatatggattatggtttcgattgaggaagttg
atactctggttgctgggaatgtacatagccatcccatttctagtaaaactttgccctgct
attcaggcaaagctggtcttcctaaactttgtgagggtcccatatttcattgacttgaaa
agaccacaggatcaaggtttaaaccacacctgtaattattacttgcagccagaggaggat
gtaaccattggagtctggcacacggtccctgcagccttgtggaagaatgcccgagggaag
gaccagctgtggtttgaagaagctttgggctccagccatcctgtaatcctttacctgcat
ggcaatgcaggaacaagaggaggggatcaccgtgtggagctttacaaggttctcagctcc
ctcgggtaccacgtggtgacgtttgactatcgaggctggggtgactcaataggcagcccg
tcagagaggggaatgacctatgatgcccttcatgtcttcgactggataaaagcacggagt
ggagacaaccctgtctatatatggggacactccctgggcacaggagttgcaacaaatctg
gtgcggcggctctgcgagagagaaacacctccggatgctctgatcctggaatctccattc
accaacatacgggaggaggcacggagtcaccccttttctgtgatatacagatacttccct
ggatttgattggttcttccttgaccccatcacgacgagtggaattaaatttgcaaacgat
gagaatgtgaaatacatttcctgctccctgctcatccttcatgctgaggatgatccagtg
gtaccatttcatctgggaaaaaagctttacaacatcgcggcgacgtcgcggagtttccgg
gactacaaggtgcagtttgtgcccttccacacagacctcggctaccggcacaagtacatc
tacaggagtccagagctacctcggatactgcgggaattcctgggaaaatctgaacatgag
catcatcactga

DBGET integrated database retrieval system