KEGG   Prochlorococcus marinus AS9601: A9601_01311Help
Entry
A9601_01311       CDS       T00464                                 

Gene name
hemD
Definition
uroporphyrinogen III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A9601_01311 (hemD)
Enzymes [BR:pmb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     A9601_01311 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
124764..125561
Genome map
AA seq 265 aa AA seqDB search
MPKVDLPLDQRNIIITRSKEGILDIKKIFISKGANVFDLPAISIGDPDDLNPLDEALNQI
NDFHWIIFSSSNGIKFVDKRLRYFNSSLKECSKKTKIAVVGEKTSKTLDDFGIKADFIPP
EFVAESLIDNFPVSGYGLRVFVPRVQTGGRDFIADQFRKAGSRVFEVAAYETRCPESIPE
ETIDIISNRKVDAIIFSSGKTVVNAAFLLEKNLGKKWLEYFDQIKLLTIGPQTTKICNKI
FGRFDSQAQKYTFEGLLDVAINIFS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaagttgatctaccccttgatcaaagaaatataattattactcgatcaaaagaa
gggatattggatataaaaaagatattcataagcaagggcgctaatgtatttgatttacct
gcaataagtattggtgatccagatgatttgaatcctcttgacgaagcattaaatcaaata
aatgattttcattggattattttttccagtagtaatgggatcaaatttgtggataaaaga
cttagatactttaatagttcattaaaagaatgttctaaaaaaacaaaaatcgccgtagtc
ggagaaaaaacctcaaaaactcttgatgattttgggattaaggctgatttcatacctcca
gaatttgttgctgaaagtttaattgataatttcccagtatctggttatggacttcgagtt
tttgtaccaagagttcaaacaggtggtagggatttcattgcagatcaatttagaaaggct
ggttctcgtgtatttgaggttgctgcatatgagactagatgtcctgaatcaattccggaa
gaaacaattgatattatttctaatcgaaaagttgatgcaattattttctcaagtggtaaa
accgtagtaaatgctgcttttttactagaaaaaaatcttggtaaaaaatggttagaatat
tttgatcaaattaagttattaactattggacctcagacaacaaaaatatgtaacaagatt
tttggaagatttgatagtcaggcacaaaaatatacttttgaaggactactagatgtagca
attaatatttttagttag

DBGET integrated database retrieval system