KEGG   Prochlorococcus marinus AS9601: A9601_01541Help
Entry
A9601_01541       CDS       T00464                                 

Gene name
fabD
Definition
malonyl coenzyme A-acyl carrier protein transacylase (EC:2.3.1.39)
Orthology
K00645  
[acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
Fatty acid biosynthesis
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:pmb01212]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:pmb00061]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
145151..146047
Genome map
AA seq 298 aa AA seqDB search
MKVAWVFPGQGSQKIGMAKQIENLPITKERFSYASEIFERNLFEICELNTEPTNPLLDLN
YTKNTQICLFLVESILLDALKENGFKPTYVAGHSLGEITALYCSDVFSFEDCVSLIKERS
QLMVNAGKGSMAAVIGFDRNQLDLLVQKIDDIVIANDNSSSQVVLSGSTEALDNLSKEIA
CKRFLKLNVSGAFHSPFMNEPSSKFCEYLKKIKFNNPSFPVISNYEPSLCSDPNELKIRL
EKQMCNGVRWRETMDLMAKDSDLHIVEIGPSNVLSGLAKRHLKDVKISQVSSSDQISY
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgcatgggtattccctggacagggttcgcaaaaaattggaatggcaaaacaa
attgaaaatctgccgatcacaaaagagaggtttagctatgcttctgagatatttgagaga
aatttatttgaaatttgtgaattaaatactgaaccaacaaatcctcttcttgatttgaat
tacacaaaaaatacacaaatttgtctttttttagttgaatcaattttattagatgcatta
aaggaaaatggatttaaaccaacttatgttgcgggacacagtcttggagaaatcactgca
ctatattgttcggatgttttttcattcgaagattgtgtttctcttataaaagaaaggtct
caattaatggtcaatgctggtaaaggatctatggcagcagtaattggttttgatagaaat
caacttgatttattagtgcaaaaaattgatgatattgtaattgctaatgataatagctct
tcccaagttgtcttatcaggatctactgaagccttagataatttatcgaaagaaattgct
tgtaaaagattcttgaaattaaatgtttcaggagcatttcattcaccatttatgaatgaa
ccttcatcaaaattttgtgagtatttaaaaaagattaaatttaacaatccttctttccct
gtgataagtaattatgaaccttcactgtgtagcgatccaaacgagcttaaaattagatta
gaaaagcaaatgtgtaatggagtgaggtggcgagaaactatggatttaatggcaaaagat
agtgatcttcatattgtcgaaattggcccttctaatgtactaagtggtttagcaaaaaga
catcttaaagatgtaaaaatttctcaagtatcatcttctgatcaaatatcttattaa

DBGET integrated database retrieval system