KEGG   Prochlorococcus marinus AS9601: A9601_01821Help
Entry
A9601_01821       CDS       T00464                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A9601_01821 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A9601_01821 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A9601_01821 (trpB)
Enzymes [BR:pmb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     A9601_01821 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(169302..170546)
Genome map
AA seq 414 aa AA seqDB search
MVSTFSRKDQNYKNDDLNQPSIEGRFGKYGGQYVPETLMPALFELEDAASNAWKDKLFVE
ELNHLLKTYVGRETPLYEAKRLTEHYKNKQATPRIWLKREDLNHTGAHKINNALGQALLA
IRMGKKRIIAETGAGQHGVATATVCARFGLKCIIYMGAEDIKRQSLNVFRMKLLGAEVKV
VNSGTATLKDATSEAIRDWVSNVETTHYILGSVAGPHPFPKIVRDFHAVIGEETKKQCLE
SFGSLPDILLACVGGGSNAMGLFHPFVKETSVRLIGVEAAGSGVDTDKHAATITKGSVGI
LHGSMSLLLQDDNGQVQEAHSISAGLDYPGVGPEHSHLKDIGRAEYGSVTDQEALDALKL
VSELEGIIPALETAHAFAWLDKLCPTLEKDTNIVINCSGRGDKDVNTVASSLDI
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtggtaagtacattttctcgcaaagatcaaaactataaaaatgacgatttaaatcaaccc
tccatagagggaagatttggaaaatatggtggtcaatatgttcctgaaacgctaatgccc
gctctttttgagcttgaagacgctgcgtctaatgcatggaaagataaactttttgtagaa
gaattgaatcacctactcaagacttatgtaggaagagaaacaccactttatgaagccaaa
agacttactgaacattacaaaaataaacaagcaactcctaggatatggcttaaaagagaa
gatttaaatcatactggggctcacaaaattaataatgctcttggacaagctttattggca
ataagaatgggcaaaaaaagaataattgcagaaactggagcaggtcagcacggagttgct
actgctactgtttgtgcgagatttggcttgaaatgtattatctacatgggtgctgaagat
ataaaaaggcaatcccttaacgttttcagaatgaaacttttaggagctgaagttaaagtt
gtaaattctggaactgcaacacttaaggatgctactagtgaggccattagagattgggtt
tctaatgtcgaaaccacacactacattttaggatctgttgcaggcccacaccctttccca
aagattgtgcgcgattttcatgcagttataggtgaagaaactaaaaaacaatgtttggaa
tcatttggatctttacccgatattttgcttgcttgtgtaggtggaggatcaaatgcaatg
gggcttttccatccttttgttaaagaaacttctgtgcggcttattggagttgaagccgca
ggaagcggagttgatactgacaaacatgctgccactatcactaaagggtcagttggaatt
ttgcatggatcaatgagtcttctcttgcaagatgataatggtcaagtacaagaagctcac
tcaataagtgcaggtttagattaccctggagtaggtcctgaacatagccatttaaaagat
ataggcagagcagaatatggatcagtcacagatcaagaagctttggacgctttaaaactt
gttagtgaactagaaggaattatacctgcacttgaaactgcccatgcttttgcttggtta
gataaattatgccctactcttgaaaaagatactaatatagtaatcaattgctctggtaga
ggcgacaaagatgttaatactgttgcatcttcattagatatttaa

DBGET integrated database retrieval system