KEGG   Prochlorococcus marinus AS9601: A9601_02111Help
Entry
A9601_02111       CDS       T00464                                 

Gene name
rluD
Definition
pseudouridylate synthase specific to ribosomal large subunit (EC:4.2.1.70)
Orthology
K06180  
23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
pmb  Prochlorococcus marinus AS9601
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(196692..197651)
Genome map
AA seq 319 aa AA seqDB search
MELNNQNSFGIGEGELIEIIYELPLPMRLDRWLVSKRPEQSRARIQHFINSGLVLVNYKT
AKAKTPLKNGDNIQIWMPPPEPLIYLKPEKMDLNILFEDEHIIVINKQSGLIVHPAPGHK
SGTLVNGLLFHCKDLPGINGKLRPGIVHRLDKDTSGCMVVAKSQEALVNLQKQIKEKIAS
REYIAVIHGAPNSEEGQIVGNIGRDKLNRLKYKVVEETSGRYACTYWKLEERFGNYSLMS
FKLDTGRTHQIRVHCAHINHPIVGDPLYGRCKKLPCKLDGQALHAIKLGLIHPINGKEMI
FESELPLDFQKLLSVLKIK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggaattaaataatcaaaattctttcggcattggagaaggtgagcttatagaaattatt
tatgagctacctcttcctatgaggctagacagatggttggtaagtaaaaggccagaacaa
agtagagcaagaattcaacattttataaattcaggtttagtacttgtaaactataagact
gcgaaagcaaagaccccattaaaaaatggcgacaatattcaaatatggatgcctcctcca
gaacctcttatttatttgaaacctgaaaaaatggatttaaatatcctttttgaagacgag
cacatcatagtaattaataaacaatcaggactaattgttcatccagcccctggacacaaa
tctggaactttagtgaatggattactttttcactgtaaagatctacctggaattaatggg
aaattaagacctgggattgttcacagattagataaagatacctccggatgtatggttgtt
gcaaaaagccaagaggcattagtaaatctccagaaacaaattaaagaaaaaatagcatca
cgcgaatatattgcagtaattcatggagcaccgaattctgaagaaggccaaatagtggga
aacattggcagagataaattaaatagattgaaatataaagtagttgaagaaacttcagga
aggtatgcctgtacctattggaaattagaagaaagatttggcaattactcattaatgagt
ttcaagctagatacggggcgaacgcatcaaataagagtacattgcgctcacattaatcat
ccaattgtgggtgatccgttatatggaagatgtaaaaaactaccatgtaaattagatggc
caagctttacacgccattaagcttggacttatacatccaataaatggtaaagaaatgata
tttgaatcagaattaccattagattttcaaaaattactaagtgttcttaaaattaaataa

DBGET integrated database retrieval system