KEGG   Prochlorococcus marinus AS9601: A9601_02351Help
Entry
A9601_02351       CDS       T00464                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pmb00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
218928..219929
Genome map
AA seq 333 aa AA seqDB search
MNSIIRPRRLRRTESIREMVRENHLAASDFIYPLFIHEKDFKEEISAMPGTYRWDIDGLL
KEVTRAWELGIRCVVLFPKINDSLKTEDGAECFNEDGLIPKAIRILKKEIPEMAIMTDVA
LDPYSCDGHDGLVDETGKILNDETIEILKKQALTQARAGADFIGPSDMMDGRVGAIRTAL
DSEGFSDVGIISYTAKYSSAYYGPFRTALDSAPRENSKKVIPDNKSTYQMDPANSKEALI
ESALDQYEGADILMVKPGISYLDIVYRISTFSNKPIAAYNVSGEYSMVKSAAMKNWINEK
DIVLETLLSFKRAGAKLILTYHACDASQWLQDT
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgattattcgtccaagaagattaagaagaactgagtcaataagagaaatggtt
agagaaaaccatttggcggcatcggactttatctatccattatttattcatgagaaagat
tttaaagaggaaatttccgcaatgcccggaacttatagatgggatattgatggtttacta
aaggaggttactagggcatgggaattgggaattagatgtgtggttcttttcccaaaaatt
aatgatagcttaaagactgaagatggagcagaatgttttaatgaggacggtttaatacct
aaagctattcgaatattaaaaaaagagattccagaaatggcaataatgacagatgttgcc
ttggacccttactcctgtgatggacatgatggcttagttgatgaaactggaaaaatattg
aatgatgaaacgattgaaattttaaaaaaacaagctttaactcaagctagagctggagca
gattttattggccctagtgacatgatggatgggagagttggagcaattaggactgctctt
gatagtgaaggatttagtgatgtaggtattattagttatacagctaaatattcatctgct
tattatggtccgtttagaactgctttagattcggctcctagagaaaatagtaagaaagta
attccagacaataagtctacatatcaaatggaccctgccaattcaaaagaggctttaatt
gaatctgcattggatcagtatgaaggagctgatattttgatggtaaaaccaggaatttca
tatttggatattgtttatagaataagcacattttcaaataagcccatagctgcatacaac
gttagtggggagtattccatggtaaagtctgctgctatgaagaactggattaacgaaaaa
gatattgttttagagacattgcttagttttaaaagagcaggagcaaaattaatactcact
tatcatgcttgtgatgcatctcaatggttgcaggatacttaa

DBGET integrated database retrieval system