KEGG   Prochlorococcus marinus AS9601: A9601_03101Help
Entry
A9601_03101       CDS       T00464                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pmb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(286566..287132)
Genome map
AA seq 188 aa AA seqDB search
MELSNLNIKNGLCISLGANIDSKFGSPLESLLICKPKIEEIINEWGDSSNEKKEEKSEFH
ANFFWSSIYETLPHGVENEQPNYLNTLLLIKSNSFPKPSNKNAKLLLKELKKLEKFFGRE
KTPKGKKWLSRCLDLDILWWEDFHTIDEELTLPHPRFMNRNFVITPLSEILSRSQKITKF
DDPKWSIN
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
gtggaattatcaaatcttaatatcaaaaatggcctatgtatatccctcggagcaaatatt
gatagtaaattcggaagccctcttgagtcactattaatttgcaaaccaaaaatagaggaa
ataataaatgagtggggagatagttccaacgaaaaaaaagaagagaaaagcgaatttcat
gcaaactttttttggtcttcaatttatgagacattacctcatggtgttgaaaatgagcag
ccaaattatttaaatactctattacttataaaaagtaattctttccctaaaccatcaaat
aaaaacgcgaagttacttttaaaagagctaaaaaagttagagaaatttttcggacgagaa
aagacgccaaagggtaagaaatggttatcaagatgtctcgatttagatattctttggtgg
gaagattttcatacgattgacgaggaactaacattacctcaccctagattcatgaatcgg
aatttcgttattacacctctatctgaaatcctaagtagaagccaaaaaataacaaagttt
gatgatccaaaatggtctattaattga

DBGET integrated database retrieval system