KEGG   Prochlorococcus marinus AS9601: A9601_04551Help
Entry
A9601_04551       CDS       T00464                                 

Gene name
pdhC
Definition
branched-chain alpha-keto acid dehydrogenase subunit E2 (EC:2.3.1.12 2.3.1.61)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:pmb01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pmb00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pmb00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pmb00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
394884..396251
Genome map
AA seq 455 aa AA seqDB search
MSHEIFMPALSSTMTEGKIVEWLKNPGDKVARGESVLVVESDKADMDVESFQDGYLAAVL
MPAGSTAPVGETIGLIVENEDEIASVQEQNKGNQPEVSSSDQLELVSNKTEEKPLVQTEI
VEKQEKEVVLMSEKAAPSSNSDQINAATSNVSSRVIASPRAKKLASQMGVDLAKVHGSGP
HGRIQADDILKANGQPVSIPWIGEGGSPASIPGVNLGVESKPEASGNSFGNPGETVQFNT
LQKAVNKNMESSLDVPCFRVGYSINTDKLDNFYKKVKQNGVTMTALLVKAVAKTLKKHPQ
VNSSFSENGISYPENINIAVAVAMEDGGLITPVLKEPCNTDLFELSREWKDLVKRSRSKQ
LEPDEYSTGTFTLSNLGMFGVDRFDAILPPGTGAILAIASSKPTVVANSDGSISVKKIMQ
VNLTADHRVIYGADGASFLKDLASLIQDEPETLVS
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacgaaatattcatgcctgccttgagttctaccatgacggagggcaagattgtg
gaatggttgaaaaatccaggagataaagttgcaagaggtgaatctgtcttggttgttgaa
tctgacaaggcagatatggatgttgaatcttttcaagatggataccttgcagctgtttta
atgcctgctggcagcactgcaccagtaggagagactatcggtttaattgtagaaaatgag
gatgagatagcttctgttcaagaacaaaataaaggaaatcaacccgaagtttctagttcg
gatcaacttgaattggtaagcaataaaactgaagaaaaacctttggttcaaactgaaatt
gttgaaaaacaagaaaaagaagttgtattaatgagtgaaaaggcagccccatcttctaat
agtgatcaaataaatgctgctacgagtaatgtttcttcgagggtgattgcatctccaaga
gctaaaaaacttgcctctcaaatgggtgttgatttagcaaaggttcatggatcaggacct
catggaaggattcaagccgatgatattttaaaagctaatggccaaccagtctctatacca
tggataggcgaaggtggttctcctgcaagtatccctggtgtaaatttgggggttgaaagt
aaaccagaagcttcaggaaatagttttggtaatcccggagaaacagttcaatttaatact
cttcaaaaagcggtaaataaaaatatggaatctagtttagatgtgccatgttttagagtg
ggttactccatcaacacagataaattagataatttttataaaaaagtaaaacagaatgga
gtgactatgactgctttactagttaaagcagttgctaagacactaaagaaacaccctcaa
gttaactcaagtttttcagaaaatggaatttcttatccagaaaatataaatattgctgtt
gctgtagcgatggaagatggtggactaataactccagttttaaaagaaccatgcaatact
gatttatttgaattgtctagggaatggaaagatctcgtaaaaagatcaagatcaaaacaa
ttagaacccgatgaatactcaacgggaaccttcactttatctaaccttgggatgtttgga
gttgatagatttgacgcaattcttcctccaggtaccggtgctattttagccatagcatca
tcgaaaccaaccgttgttgctaatagtgatggttcaatatctgttaaaaaaataatgcaa
gtaaatctaacggctgatcatagagtgatctatggagctgatggagcttcattcttaaaa
gacttggcttccctaattcaagatgagccagagactcttgtctcctaa

DBGET integrated database retrieval system