KEGG   Prochlorococcus marinus AS9601: A9601_04551Help
Entry
A9601_04551       CDS       T00464                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
pmb00010  Glycolysis / Gluconeogenesis
pmb00020  Citrate cycle (TCA cycle)
pmb00620  Pyruvate metabolism
pmb01100  Metabolic pathways
pmb01110  Biosynthesis of secondary metabolites
pmb01120  Microbial metabolism in diverse environments
pmb01130  Biosynthesis of antibiotics
pmb01200  Carbon metabolism
Module
pmb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9601_04551 (pdhC)
   00020 Citrate cycle (TCA cycle)
    A9601_04551 (pdhC)
   00620 Pyruvate metabolism
    A9601_04551 (pdhC)
Enzymes [BR:pmb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     A9601_04551 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Sigma_reg_C MadL
Motif
Other DBs
NCBI-ProteinID: ABM69743
CYORF: A9601_04551
UniProt: A2BPN2
Position
394884..396251
Genome map
AA seq 455 aa AA seqDB search
MSHEIFMPALSSTMTEGKIVEWLKNPGDKVARGESVLVVESDKADMDVESFQDGYLAAVL
MPAGSTAPVGETIGLIVENEDEIASVQEQNKGNQPEVSSSDQLELVSNKTEEKPLVQTEI
VEKQEKEVVLMSEKAAPSSNSDQINAATSNVSSRVIASPRAKKLASQMGVDLAKVHGSGP
HGRIQADDILKANGQPVSIPWIGEGGSPASIPGVNLGVESKPEASGNSFGNPGETVQFNT
LQKAVNKNMESSLDVPCFRVGYSINTDKLDNFYKKVKQNGVTMTALLVKAVAKTLKKHPQ
VNSSFSENGISYPENINIAVAVAMEDGGLITPVLKEPCNTDLFELSREWKDLVKRSRSKQ
LEPDEYSTGTFTLSNLGMFGVDRFDAILPPGTGAILAIASSKPTVVANSDGSISVKKIMQ
VNLTADHRVIYGADGASFLKDLASLIQDEPETLVS
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacgaaatattcatgcctgccttgagttctaccatgacggagggcaagattgtg
gaatggttgaaaaatccaggagataaagttgcaagaggtgaatctgtcttggttgttgaa
tctgacaaggcagatatggatgttgaatcttttcaagatggataccttgcagctgtttta
atgcctgctggcagcactgcaccagtaggagagactatcggtttaattgtagaaaatgag
gatgagatagcttctgttcaagaacaaaataaaggaaatcaacccgaagtttctagttcg
gatcaacttgaattggtaagcaataaaactgaagaaaaacctttggttcaaactgaaatt
gttgaaaaacaagaaaaagaagttgtattaatgagtgaaaaggcagccccatcttctaat
agtgatcaaataaatgctgctacgagtaatgtttcttcgagggtgattgcatctccaaga
gctaaaaaacttgcctctcaaatgggtgttgatttagcaaaggttcatggatcaggacct
catggaaggattcaagccgatgatattttaaaagctaatggccaaccagtctctatacca
tggataggcgaaggtggttctcctgcaagtatccctggtgtaaatttgggggttgaaagt
aaaccagaagcttcaggaaatagttttggtaatcccggagaaacagttcaatttaatact
cttcaaaaagcggtaaataaaaatatggaatctagtttagatgtgccatgttttagagtg
ggttactccatcaacacagataaattagataatttttataaaaaagtaaaacagaatgga
gtgactatgactgctttactagttaaagcagttgctaagacactaaagaaacaccctcaa
gttaactcaagtttttcagaaaatggaatttcttatccagaaaatataaatattgctgtt
gctgtagcgatggaagatggtggactaataactccagttttaaaagaaccatgcaatact
gatttatttgaattgtctagggaatggaaagatctcgtaaaaagatcaagatcaaaacaa
ttagaacccgatgaatactcaacgggaaccttcactttatctaaccttgggatgtttgga
gttgatagatttgacgcaattcttcctccaggtaccggtgctattttagccatagcatca
tcgaaaccaaccgttgttgctaatagtgatggttcaatatctgttaaaaaaataatgcaa
gtaaatctaacggctgatcatagagtgatctatggagctgatggagcttcattcttaaaa
gacttggcttccctaattcaagatgagccagagactcttgtctcctaa

DBGET integrated database retrieval system