KEGG   Prochlorococcus marinus AS9601: A9601_06281Help
Entry
A9601_06281       CDS       T00464                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A9601_06281 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A9601_06281 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A9601_06281 (trpA)
Enzymes [BR:pmb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     A9601_06281 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
548931..549758
Genome map
AA seq 275 aa AA seqDB search
MQINKNESLSKVDEMFSELKNKKKFALMPFIMAGDPNIEITSEILLKLQENGADLVELGI
PYSDPLADGPVIQLAASRALKSGTSLRKVIKLLESLKGKLNIPIILFSYLNPLLCFGFER
FCEMASDAGVSGLIVPDLPLEEAYKFSKIVSHHSMDLILLVAPTTPFERMKQISNHTKGF
TYLVSVTGVTGERNKMENRVENLIAKLKDVNSNPIAVGFGISTPEHVNKVREWGADGVII
GSAFVKRISSLGEKDVVDHVGEFCKEMRLAADQKK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattaataaaaatgaatctttatctaaggtagatgaaatgtttagtgagttaaaa
aataaaaaaaaatttgctttaatgccttttataatggctggggatcccaatattgaaata
acgtctgagatattattaaagttacaagaaaatggagctgaccttgttgaattaggcatc
ccgtatagtgacccacttgcagatggtcctgttattcaattggcggcctctcgcgcctta
aagtcaggtactagcttaagaaaagtaattaaacttttagagtctttaaaaggtaaatta
aatattcccatcatccttttttcttacttgaatccattactatgttttggctttgaaagg
ttttgtgagatggcatctgatgctggagtttctggactaatagttcctgacctccctttg
gaggaagcttataaattttctaaaatagttagtcaccattctatggacttaattttatta
gtagcgccaactactccttttgaaagaatgaaacaaatatcaaatcatacaaaaggcttt
acttatttagtaagtgttacgggtgtcactggtgagagaaataaaatggaaaatagagta
gaaaatcttattgctaaattaaaagatgtaaatagcaatccaattgctgttggttttgga
atatcaactccagaacacgttaataaagttcgtgagtggggagcagatggagtaattatt
gggagtgcatttgtaaaaagaatctcgagcttaggtgaaaaggatgttgtcgatcacgtt
ggtgagttttgtaaagaaatgcgtttagctgcggatcaaaaaaaataa

DBGET integrated database retrieval system