KEGG   Prochlorococcus marinus AS9601: A9601_06281Help
Entry
A9601_06281       CDS       T00464                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pmb01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pmb00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pmb00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
548931..549758
Genome map
AA seq 275 aa AA seqDB search
MQINKNESLSKVDEMFSELKNKKKFALMPFIMAGDPNIEITSEILLKLQENGADLVELGI
PYSDPLADGPVIQLAASRALKSGTSLRKVIKLLESLKGKLNIPIILFSYLNPLLCFGFER
FCEMASDAGVSGLIVPDLPLEEAYKFSKIVSHHSMDLILLVAPTTPFERMKQISNHTKGF
TYLVSVTGVTGERNKMENRVENLIAKLKDVNSNPIAVGFGISTPEHVNKVREWGADGVII
GSAFVKRISSLGEKDVVDHVGEFCKEMRLAADQKK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattaataaaaatgaatctttatctaaggtagatgaaatgtttagtgagttaaaa
aataaaaaaaaatttgctttaatgccttttataatggctggggatcccaatattgaaata
acgtctgagatattattaaagttacaagaaaatggagctgaccttgttgaattaggcatc
ccgtatagtgacccacttgcagatggtcctgttattcaattggcggcctctcgcgcctta
aagtcaggtactagcttaagaaaagtaattaaacttttagagtctttaaaaggtaaatta
aatattcccatcatccttttttcttacttgaatccattactatgttttggctttgaaagg
ttttgtgagatggcatctgatgctggagtttctggactaatagttcctgacctccctttg
gaggaagcttataaattttctaaaatagttagtcaccattctatggacttaattttatta
gtagcgccaactactccttttgaaagaatgaaacaaatatcaaatcatacaaaaggcttt
acttatttagtaagtgttacgggtgtcactggtgagagaaataaaatggaaaatagagta
gaaaatcttattgctaaattaaaagatgtaaatagcaatccaattgctgttggttttgga
atatcaactccagaacacgttaataaagttcgtgagtggggagcagatggagtaattatt
gggagtgcatttgtaaaaagaatctcgagcttaggtgaaaaggatgttgtcgatcacgtt
ggtgagttttgtaaagaaatgcgtttagctgcggatcaaaaaaaataa

DBGET integrated database retrieval system