KEGG   Prochlorococcus marinus AS9601: A9601_06521Help
Entry
A9601_06521       CDS       T00464                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pmb01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pmb00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pmb00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pmb00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pmb00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:pmb00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(575153..576187)
Genome map
AA seq 344 aa AA seqDB search
MNFLACDLGGTKVLLGIFKKGTNNNSPKLIFKKKYISSDWDSFELILEDFIKKECKNITH
PSSACFAVAGPLSKNNAKIVNLSWNISGNDLQNKFNFKNCELINDFAVQIYGIPFLKKNQ
YSTIQNGSNSENTNNDLHAIVGAGTGLGIARGIISGEKVKVLASEGGHVEYSPKSKLEWD
LKIWLKNYLKVERISCERIISGTGLSRIAEWRLSKPDAQNHPLQKYLKKIKIFDAARKEL
PEKICNLSKEGDQVMIEVERIWLGAYASLLGDVALQELCFGGLWISGGTASKHFKNFKSD
LFLKQFFDKGRLKDILKTIPIKVILDEEFGLFSAACRAKMLLKT
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaattttctcgcttgtgatttaggaggtacaaaggttctattaggaattttcaaaaaa
ggaacaaataataattcgcctaagttaatatttaaaaagaaatatatatcgtctgattgg
gattcttttgaactaatcctagaagattttatcaaaaaagaatgtaagaatattactcat
ccttcttctgcatgtttcgctgtagctggtcctttatctaaaaacaacgcaaaaatcgtt
aacttgtcatggaatatttctggaaatgatttacagaacaaatttaattttaaaaactgc
gagctaataaatgatttcgctgtacaaatttatggaataccttttttaaaaaaaaatcaa
tattctactatccaaaatggatccaattctgaaaatactaataatgatttgcatgccatt
gttggagcggggactggcttggggattgcaagaggaataatatcaggggaaaaggtaaaa
gttttagctagtgaaggtggtcatgtagagtactccccaaagtcaaaattagaatgggat
ttgaaaatttggcttaagaattacctaaaagttgaaaggatatcttgtgaaaggattatt
agcggcactggtttatcaagaattgccgaatggagactaagcaaacctgatgcccaaaac
catcctttacaaaaatatttaaaaaaaattaaaatttttgatgcagcgagaaaagaacta
cctgaaaaaatttgtaatctttctaaagaaggtgatcaggtaatgattgaagttgagagg
atttggttaggtgcttatgcctctttattgggagatgttgctcttcaagaattgtgcttt
ggtggattatggatttctggaggaacagcgtcaaaacatttcaaaaactttaaatcagac
ttatttttaaaacaatttttcgacaagggaagattaaaagatattcttaaaacaatacct
ataaaagtaattttagatgaagagtttggactttttagtgcagcctgcagagcaaaaatg
cttttaaaaacttaa

DBGET integrated database retrieval system