KEGG   Prochlorococcus marinus AS9601: A9601_06751Help
Entry
A9601_06751       CDS       T00464                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
pmb00010  Glycolysis / Gluconeogenesis
pmb00620  Pyruvate metabolism
pmb00640  Propanoate metabolism
pmb00680  Methane metabolism
pmb01100  Metabolic pathways
pmb01110  Biosynthesis of secondary metabolites
pmb01120  Microbial metabolism in diverse environments
pmb01130  Biosynthesis of antibiotics
pmb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9601_06751 (acs)
   00620 Pyruvate metabolism
    A9601_06751 (acs)
   00640 Propanoate metabolism
    A9601_06751 (acs)
  Energy metabolism
   00680 Methane metabolism
    A9601_06751 (acs)
Enzymes [BR:pmb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     A9601_06751 (acs)
Lipid biosynthesis proteins [BR:pmb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   A9601_06751 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABM69961
CYORF: A9601_06751
UniProt: A2BQA0
Position
599638..601620
Genome map
AA seq 660 aa AA seqDB search
MSLDKKNSINNILEEKRIFLPSKKFAENSNISTQEELLSLKKQASNNPIQFWESFAKSEL
DWFEPFQTVLDNENAPFFKWFKEGKLNITYNCLDRHIKRGLGGKTALIWEGEPGDSKKYT
YEELLKEVCKAANALKAIGVKKGDLVCIYMPMIPEAMFAMLACARIGAPHSVVFGGFSSE
ALKDRLIDGNARFVITADGGFRKDKVIELKKAVDAAIESGADKVVEKVVVVQRSQKQISM
IDDRDFWWHELLKDQKDHCEPEIMNSEDRLFILYTSGSTGKPKGVVHTTGGYNLWSHLTF
KWIFDLKDDDIYWCTADVGWITGHSYIVYGPLSNGATTLMYEGVPRPSNLGAFWEIVQKY
KVSIFYTAPTAIRAFMKSGREIPDKYNLESLRLLGTVGEPINPEAWMWYKDVIGKDKCPI
VDTWWQTETGGVMISPLPGVVATKPGSATFPLPGIEVEIVDKNGDKVKENEGGYLIIKKP
WPGMMRTIHGNSERYLESYWEYITFKGEKNVYFAGDGARIDEDGYIWIMGRVDDVISVSG
HRLGTMEIESALVSHKSVAESAVVGKKDDLKGEVIVAFVSLEKDVKSSSELVENLKNHVV
NEIGIIAKPEKIIISDSLPKTRSGKIMRRILRSLAAGEKISGDISTLEDSSVLEKLKELS
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtcattagataaaaaaaattcaatcaataacatacttgaagaaaagagaattttcctt
ccatcaaaaaaatttgcagaaaactcaaatattagtactcaagaagaattactaagtcta
aaaaaacaagcatcaaataatcctattcaattttgggaatcttttgcaaaatcggaacta
gattggtttgagccatttcaaactgtattagataacgaaaatgcgcccttttttaaatgg
ttcaaagaagggaaactcaatattacatataactgcttagatagacacattaagagaggg
cttggaggaaagaccgcacttatatgggagggcgaacccggagatagcaaaaaatacact
tacgaagaacttctaaaagaggtatgtaaagcagctaatgcattaaaagcaattggtgta
aaaaaaggagatttggtttgtatttatatgccgatgattcctgaagcaatgtttgcgatg
ttagcttgtgcaagaattggtgctcctcattcagttgtcttcggaggattttcttcagaa
gctttaaaagataggttaattgatggaaacgccagatttgttattactgctgatggtggc
tttagaaaagataaggtgattgaacttaagaaagcagttgatgcggccattgaaagtggg
gcagataaagttgttgaaaaagtcgttgttgttcaacgatctcaaaaacaaatttcgatg
attgatgatagagatttttggtggcacgaattattaaaagatcaaaaagatcattgtgaa
ccagaaataatgaatagcgaagatagactttttattctttatacttcaggctctactgga
aagcccaaaggtgtagttcacactacaggtggatacaatctttggtcccatttgacattt
aaatggatttttgacttaaaagatgacgatatttactggtgtactgctgatgttggttgg
attacaggtcatagttacatagtttatgggcctttatccaatggtgctacaaccttaatg
tatgagggagtgccaagaccctcaaatttgggagctttttgggagattgttcaaaaatat
aaggtttctattttttatactgcaccaacagcaataagggcatttatgaagtctgggcgt
gaaatacccgataaatataatttggagagtcttagacttttgggcactgttggagaacca
attaatcctgaagcatggatgtggtacaaggatgttattggtaaagataaatgccctatt
gttgatacttggtggcaaactgagactggtggagtgatgataagtcccttgcctggagtc
gttgctacaaagccaggttccgccactttccctctgccaggaatcgaagttgaaattgtc
gataagaatggagataaggttaaggagaacgagggtggctatttaattattaagaaacct
tggccaggaatgatgagaacaattcacggaaactcagagagatatttggagagttattgg
gaatatattacctttaaaggagaaaaaaatgtttattttgctggagatggagcacgcatt
gatgaagatggatatatatggattatgggcagagttgatgatgtcataagtgtttcagga
catcggttaggaacaatggaaatagaatctgctttggtaagtcataaatcagttgcagag
tctgcagtcgttggcaaaaaagatgatttaaaaggtgaagttatagtcgcttttgtatct
ctagagaaagatgtgaaaagttcttcagaattagtagagaatttaaagaatcatgttgtt
aatgaaattggaattatcgcaaagcctgaaaaaattataatttctgactctcttccgaaa
acacgtagtggaaaaattatgaggcgaattttaagatctttggctgctggagaaaaaatt
agtggtgatattagcactcttgaagatagttctgttttggaaaagctgaaagaattatcc
taa

DBGET integrated database retrieval system